SecReT6
Protein ID: 187922949
SecReT6 ID284
T6SS typei3
Gene symbol-
Locus tagBphyt_0948
StrainBurkholderia phytofirmans PsJN
Repliconchromosome I [GenBank: NC_010681] [Browse all T6SS(s) in this replicon]
Location [Strand]1067492..1068598 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDB2T110
KEGG IDbpy:Bphyt_0948
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.10E-22, Aligned region: 71..130
ImpA-rel_N [PF06812], Evalue: 4.10E-22, Aligned region: 209..222
Protein Sequence: 368 a.a.     [Download]
>gi|187922949|ref|YP_001894591.1| unnamed protein product [Burkholderia phytofirmans PsJN]
MSSSKRQATAKVAAVKAVTPLPHDWMSPVDAAAPCGADLEYDPEFVVLSAQMAVKVDAQYGDFVGIPEPV
NWSEVERDCRRLMMRSKDMRLAVWFTRCRTRLAAGAGLAEGLGLLAAWLAAFPGALHPQPGVDDDQEAAL
EIRMNALQALTDSDGLLSDLREIALTRSTATRLQMRDVERAFAHPRPSDALAPESVTRQLEDLRIQQPDM
LRGFDDALASLESIDVWCKAHLGVYLPDLAALTRLLRRVVGDRSRVTVAPVDGLTEVMPSDDAGAAASSN
EETRVEHDDISPPAGCAAPVSLGVSVAAAGREGALERIREARYWFEQHEPSSPIPVLLKRAERFVGKRYV
DVVKAIPTELLEQWDSEE
 
Nucleotide Sequence: 1107 bp     [Download]
>gi|187922035|ref|NC_010681.1|:1067492-1068598 Burkholderia phytofirmans PsJN chromosome 1, complete sequence
ATGAGTAGCAGCAAGAGACAAGCGACGGCGAAGGTGGCGGCGGTCAAGGCCGTCACACCCCTGCCTCACG
ACTGGATGTCACCGGTCGATGCCGCCGCCCCGTGCGGGGCCGACCTCGAATACGACCCGGAATTCGTCGT
GCTGTCCGCGCAGATGGCGGTGAAAGTGGACGCACAGTACGGCGACTTCGTGGGCATACCGGAACCCGTG
AACTGGAGCGAGGTCGAGCGCGATTGCCGACGCCTGATGATGCGCAGCAAGGACATGCGTCTCGCGGTGT
GGTTCACGCGTTGCCGCACGAGGCTCGCGGCAGGGGCGGGACTGGCGGAAGGGCTGGGGCTGTTGGCCGC
ATGGCTCGCCGCGTTTCCCGGTGCGCTCCATCCCCAGCCCGGTGTCGACGACGATCAGGAAGCGGCGCTC
GAAATCCGCATGAACGCTTTGCAGGCGTTGACAGATTCGGATGGATTGCTCTCTGACCTGCGGGAGATCG
CGTTGACGCGTTCGACCGCCACGCGGCTTCAGATGCGCGATGTCGAGCGCGCGTTTGCACATCCGCGGCC
GAGCGATGCGCTCGCGCCCGAGTCCGTTACGCGGCAACTTGAGGATCTGCGCATCCAGCAACCGGACATG
CTTCGGGGCTTCGATGACGCGCTCGCGAGCCTGGAGTCCATCGACGTTTGGTGCAAGGCGCATCTGGGCG
TCTACTTGCCGGACCTCGCTGCTCTCACGCGGCTGTTGCGGCGCGTAGTGGGAGATCGCTCGCGCGTGAC
GGTGGCGCCGGTTGACGGATTGACGGAGGTGATGCCGTCCGACGATGCCGGTGCGGCGGCATCGTCGAAC
GAGGAGACGCGCGTCGAGCATGACGACATTTCGCCACCGGCCGGTTGCGCTGCGCCGGTTAGCCTCGGCG
TCAGCGTGGCAGCGGCGGGTCGTGAGGGCGCTTTGGAGCGTATTCGGGAAGCTCGATACTGGTTCGAGCA
ACACGAACCGAGCAGCCCAATCCCCGTGTTGCTGAAGCGCGCGGAACGGTTTGTGGGGAAACGGTATGTG
GATGTCGTCAAGGCCATTCCCACGGAGTTGCTTGAACAATGGGATAGCGAAGAGTAG