SecReT6
Protein ID: 187931783
SecReT6 ID477
T6SS typeii
Gene symbol-
Locus tagFTM_1091
StrainFrancisella tularensis subsp. mediasiatica FSC147
Repliconchromosome [GenBank: NC_010677] [Browse all T6SS(s) in this replicon]
Location [Strand]1169669..1170190 [+]
Producthypothetical protein
NoteIglG
UniProt IDB2SEC0
KEGG IDftm:FTM_1701, ftm:FTM_1091
PDB IDNA
Domain hit(s) vs Pfam DUF4280 [PF14107], Evalue: 1.10E-16, Aligned region: 58..167
Protein Sequence: 173 a.a.     [Download]
>gi|187931783|ref|YP_001891768.1| hypothetical protein FTM_1091 [Francisella tularensis subsp. mediasiatica FSC147]
MLNIINDSLKRLEEITTNDESISSSVSDLVADLNNIKILLAQSKLHLSSNASILTTSMGAQIKCSYSLGS
GIYLSTRIKTLTNNLPASNITDSKLGANILPFAGCTNPANPTMNPFSFPWVCIPNLSAFIPTNPTTLLEN
APITTINSKAMCMFAPGGIVDFISSGQINVKTS
 
Nucleotide Sequence: 522 bp     [Download]
>gi|187930913|ref|NC_010677.1|:1169669-1170190 Francisella tularensis subsp. mediasiatica FSC147 chromosome, complete genome
ATGTTAAATATTATAAATGACTCCTTAAAACGCTTGGAAGAAATAACGACCAATGATGAAAGTATTAGTA
GCTCAGTATCTGATCTAGTGGCGGATTTAAACAATATAAAAATTTTATTAGCTCAATCAAAACTACACTT
ATCAAGCAATGCGTCAATATTAACCACATCAATGGGAGCACAAATTAAATGCTCATATAGTCTTGGATCA
GGAATTTATCTTAGTACAAGAATAAAAACACTAACGAACAACTTACCAGCTTCAAATATTACCGATTCTA
AACTAGGAGCCAACATTTTACCTTTTGCTGGATGTACAAATCCAGCAAACCCTACAATGAACCCATTTAG
CTTTCCTTGGGTATGTATACCAAACTTATCTGCTTTTATCCCCACGAACCCTACTACGCTACTGGAAAAT
GCTCCTATAACTACAATAAATAGTAAAGCAATGTGTATGTTTGCTCCGGGTGGTATAGTTGATTTTATTA
GTAGTGGACAAATAAATGTAAAAACATCTTAG