SecReT6
Protein ID: 187932278
SecReT6 ID478
T6SS typeii
Gene symbol-
Locus tagFTM_1701
StrainFrancisella tularensis subsp. mediasiatica FSC147
Repliconchromosome [GenBank: NC_010677] [Browse all T6SS(s) in this replicon]
Location [Strand]1833386..1833907 [+]
Producthypothetical protein
NoteIglG
UniProt IDB2SEC0
KEGG IDftm:FTM_1701, ftm:FTM_1091
PDB IDNA
Domain hit(s) vs Pfam DUF4280 [PF14107], Evalue: 1.10E-16, Aligned region: 58..167
Protein Sequence: 173 a.a.     [Download]
>gi|187932278|ref|YP_001892263.1| hypothetical protein FTM_1701 [Francisella tularensis subsp. mediasiatica FSC147]
MLNIINDSLKRLEEITTNDESISSSVSDLVADLNNIKILLAQSKLHLSSNASILTTSMGAQIKCSYSLGS
GIYLSTRIKTLTNNLPASNITDSKLGANILPFAGCTNPANPTMNPFSFPWVCIPNLSAFIPTNPTTLLEN
APITTINSKAMCMFAPGGIVDFISSGQINVKTS
 
Nucleotide Sequence: 522 bp     [Download]
>gi|187930913|ref|NC_010677.1|:1833386-1833907 Francisella tularensis subsp. mediasiatica FSC147 chromosome, complete genome
ATGTTAAATATTATAAATGACTCCTTAAAACGCTTGGAAGAAATAACGACCAATGATGAAAGTATTAGTA
GCTCAGTATCTGATCTAGTGGCGGATTTAAACAATATAAAAATTTTATTAGCTCAATCAAAACTACACTT
ATCAAGCAATGCGTCAATATTAACCACATCAATGGGAGCACAAATTAAATGCTCATATAGTCTTGGATCA
GGAATTTATCTTAGTACAAGAATAAAAACACTAACGAACAACTTACCAGCTTCAAATATTACCGATTCTA
AACTAGGAGCCAACATTTTACCTTTTGCTGGATGTACAAATCCAGCAAACCCTACAATGAACCCATTTAG
CTTTCCTTGGGTATGTATACCAAACTTATCTGCTTTTATCCCCACGAACCCTACTACGCTACTGGAAAAT
GCTCCTATAACTACAATAAATAGTAAAGCAATGTGTATGTTTGCTCCGGGTGGTATAGTTGATTTTATTA
GTAGTGGACAAATAAATGTAAAAACATCTTAG