SecReT6
Protein ID: 188532758
SecReT6 ID285
T6SS typei3
Gene symbol-
Locus tagETA_06110
StrainErwinia tasmaniensis Et1/99
Repliconchromosome [GenBank: NC_010694] [Browse all T6SS(s) in this replicon]
Location [Strand]672050..672568 [+]
Productlipoprotein
NoteTssJ
UniProt IDB2VH79
KEGG IDeta:ETA_06110
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.80E-30, Aligned region: 22..139
Protein Sequence: 172 a.a.     [Download]
>gi|188532758|ref|YP_001906555.1| lipoprotein [Erwinia tasmaniensis Et1/99]
MTMHKISISRLVNQAFLLAALILLAGCVSTSRSVPTQYSLVFQAHPQINDSAPLKVRVLLLKSDADFMAA
DFYSLQNNPQGVLGQNLLNSEQFFLMPGQTGKKLLGQTSPEARYIGIMAEYQALDGKTWRISLPVPLPAE
RRFYQFWQGNTDNLRADIIADINGVRVVNPRD
 
Nucleotide Sequence: 519 bp     [Download]
>gi|188532165|ref|NC_010694.1|:672050-672568 Erwinia tasmaniensis Et1/99 chromosome, complete genome
ATGACTATGCACAAAATTTCGATTTCTCGCCTGGTAAACCAGGCGTTTTTACTGGCAGCCCTTATCCTGC
TGGCAGGTTGTGTTTCAACTTCACGCAGCGTTCCCACCCAGTACAGCCTGGTCTTTCAGGCACATCCTCA
GATCAACGATTCGGCCCCTCTGAAAGTACGGGTGCTGCTGCTGAAGTCAGACGCGGATTTTATGGCCGCC
GATTTCTACTCGTTGCAAAATAATCCGCAGGGCGTGCTGGGGCAAAATCTGTTGAACAGCGAGCAGTTTT
TCCTGATGCCGGGACAAACGGGTAAAAAGCTGCTTGGGCAGACCAGCCCGGAGGCGCGCTATATCGGCAT
TATGGCCGAATATCAGGCGCTTGATGGCAAAACGTGGCGGATCTCACTGCCGGTTCCTCTTCCCGCCGAA
CGCCGTTTTTATCAATTTTGGCAAGGGAATACGGATAATCTGCGCGCCGACATCATCGCCGACATCAACG
GTGTCCGTGTGGTAAACCCCCGCGATTAG