SecReT6
Protein ID: 188532759
SecReT6 ID285
T6SS typei3
Gene symbol-
Locus tagETA_06120
StrainErwinia tasmaniensis Et1/99
Repliconchromosome [GenBank: NC_010694] [Browse all T6SS(s) in this replicon]
Location [Strand]672588..673931 [+]
Producthypothetical protein
NoteTssK
UniProt IDB2VH80
KEGG IDeta:ETA_06120
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.30E-142, Aligned region: 19..443
Protein Sequence: 447 a.a.     [Download]
>gi|188532759|ref|YP_001906556.1| hypothetical protein ETA_06120 [Erwinia tasmaniensis Et1/99]
MSKAEKVVWTEGMFLRPHHFQQSENYLQSTLRDWGQAQRPWLWGLHDIEFDESMLRQGKVALLSASGLLP
DGTAFAFSNGDDAPAPLLIPDNLTQAKVVLALPARRGGREEVIFSESGDSLARFISFEREVDDFNAMAVG
PAAVQFGRLRLRLMLESELSAEWTAIGVARIAEKRNDHQLRLDGSYIPPMLNAINQSQLMEYIGDIHGLL
VQRSQQIGQRLQQPGRFNTADMVDFMLLTLINQQLGHISHVKSLPLIHPETLFHGWLTFAAELTSWMPSR
TPDGALPTYQHDDLAGCFSQLVLLLRQGLSQVMEENALQLPLTERSHGLNVATVPESSMVREFGFVLAVR
ANVPAEAIQTHFPAQMKVAPVTKIRDLVQLQLPGIMLRAMPAAPPQIPWHAGYNYFQLDKGSELWQEMEK
SGTFALHLAGEFPGLEMEFWAIRSHAV
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|188532165|ref|NC_010694.1|:672588-673931 Erwinia tasmaniensis Et1/99 chromosome, complete genome
ATGAGCAAAGCAGAAAAAGTAGTCTGGACCGAAGGAATGTTTCTGCGCCCGCATCATTTCCAGCAGAGCG
AAAACTACCTGCAAAGCACGCTGCGTGACTGGGGGCAGGCACAGCGCCCCTGGCTATGGGGCCTGCATGA
TATTGAATTTGATGAGTCGATGCTGCGCCAGGGCAAAGTCGCGCTGCTCTCCGCCAGCGGCCTGCTGCCG
GACGGCACGGCGTTTGCCTTCAGCAATGGGGACGATGCCCCAGCGCCGCTGTTGATCCCCGATAACCTCA
CCCAGGCCAAAGTGGTGCTGGCGCTGCCGGCGCGGCGCGGCGGGCGTGAAGAGGTGATCTTCAGTGAGTC
TGGTGATTCGCTGGCGCGCTTTATCAGCTTCGAACGCGAAGTGGATGATTTTAACGCGATGGCGGTCGGC
CCGGCGGCGGTCCAGTTTGGCCGTTTACGTCTGCGGCTGATGCTGGAAAGCGAACTGAGCGCCGAATGGA
CCGCTATCGGCGTGGCGCGCATCGCTGAAAAGCGCAATGACCATCAGTTACGCCTCGACGGCAGCTATAT
TCCACCGATGCTCAATGCCATCAATCAGTCACAGCTGATGGAATACATTGGCGATATCCACGGCCTGCTG
GTGCAGCGCAGCCAGCAGATCGGTCAGCGCCTGCAGCAGCCGGGGCGCTTCAACACCGCTGATATGGTCG
ATTTTATGCTGCTGACGCTGATTAACCAGCAGCTGGGGCATATCAGCCATGTGAAAAGCCTACCGCTGAT
CCATCCTGAAACGCTATTCCACGGCTGGCTGACGTTTGCGGCTGAACTGACCAGCTGGATGCCATCGCGT
ACCCCGGACGGTGCACTACCCACTTACCAACACGATGACCTGGCGGGCTGCTTCAGCCAGCTGGTGCTGC
TGCTGCGACAGGGCCTGTCGCAGGTGATGGAAGAGAACGCGCTACAGCTGCCGCTCACCGAGCGTTCTCA
CGGCCTGAACGTGGCTACGGTGCCTGAGTCCTCCATGGTGCGCGAGTTTGGCTTTGTGCTGGCGGTGCGG
GCCAACGTGCCGGCCGAAGCGATACAAACCCACTTCCCGGCGCAGATGAAGGTGGCCCCGGTGACCAAAA
TCCGCGACCTGGTTCAGCTGCAGCTGCCCGGCATTATGCTGCGGGCCATGCCGGCCGCGCCGCCGCAGAT
CCCGTGGCACGCTGGCTACAACTATTTTCAGCTCGATAAGGGCAGCGAACTGTGGCAGGAAATGGAGAAA
TCCGGCACCTTCGCGCTGCACCTGGCCGGTGAGTTTCCGGGGCTGGAAATGGAGTTCTGGGCAATTCGCA
GTCACGCAGTCTGA