SecReT6
Protein ID: 188532763
SecReT6 ID285
T6SS typei3
Gene symbol-
Locus tagETA_06160
StrainErwinia tasmaniensis Et1/99
Repliconchromosome [GenBank: NC_010694] [Browse all T6SS(s) in this replicon]
Location [Strand]679568..680587 [+]
Producthypothetical protein
NoteTssA
UniProt IDB2VH74
KEGG IDeta:ETA_06160
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.80E-19, Aligned region: 52..111
Protein Sequence: 339 a.a.     [Download]
>gi|188532763|ref|YP_001906560.1| hypothetical protein ETA_06160 [Erwinia tasmaniensis Et1/99]
MDLEALLAPITPDRPCGDNLEYDADYMAMDQASAGKAEQQFGDTIIPAEPADWNKVERLALDLLGRSKDL
RVMLALTRAWTQLKGLSGYADGLHLIQQALLLYWQPLWPSLEEDGIEDPFYRLNALAALGDKSALTAALR
QASLLRYATDEISLRDASGLLDGSKTECPGYPGGRARLQDELARGGQPGIEAVVKISERLLTIRETLTER
LGAGALPEMDQLLKTINSVAAACQATDLSTLIPAVETAASSATSAPAAAPGAQQHADWRSVQLSSRSDAQ
LMLEKVKQYFSQHEPSHPAPLMIERVQRMIELDFMDIIRDLAPDGVHQLETIFGRRDHS
 
Nucleotide Sequence: 1020 bp     [Download]
>gi|188532165|ref|NC_010694.1|:679568-680587 Erwinia tasmaniensis Et1/99 chromosome, complete genome
ATGGATCTTGAAGCGCTGCTGGCCCCGATCACGCCTGACCGCCCCTGTGGCGATAACCTTGAATATGACG
CCGACTACATGGCGATGGACCAGGCCAGCGCCGGTAAAGCCGAACAGCAGTTTGGCGATACCATCATTCC
GGCGGAACCGGCGGACTGGAACAAAGTCGAGCGGCTGGCGCTGGATCTGCTGGGGCGCAGCAAAGATCTG
CGCGTGATGCTGGCGCTGACCCGCGCCTGGACCCAGCTCAAAGGGTTGAGCGGCTACGCCGACGGCCTGC
ATCTGATCCAGCAGGCGCTGCTGCTTTACTGGCAGCCGCTGTGGCCGTCACTGGAAGAGGACGGTATAGA
GGACCCATTTTACCGCCTCAACGCGCTGGCGGCGCTGGGTGATAAATCGGCGCTGACCGCCGCGCTGCGC
CAGGCTTCGTTGCTACGCTATGCCACCGATGAAATCAGCCTGCGCGATGCCAGTGGGCTGCTCGACGGCA
GTAAAACCGAATGCCCCGGCTATCCCGGCGGCCGCGCCCGCTTACAGGATGAACTGGCGCGGGGAGGGCA
GCCCGGCATTGAGGCGGTCGTCAAGATAAGTGAGCGGTTACTGACTATTCGCGAAACTTTGACTGAACGG
CTGGGCGCGGGGGCGTTGCCGGAAATGGATCAGCTGCTGAAAACCATAAATAGCGTGGCTGCCGCCTGTC
AGGCCACCGACCTCAGTACCCTGATCCCAGCGGTTGAAACTGCCGCCAGCAGCGCCACGTCTGCGCCAGC
CGCCGCGCCTGGCGCACAGCAGCACGCCGACTGGCGCAGCGTACAGCTTAGCTCGCGCAGCGATGCGCAG
CTGATGCTGGAAAAAGTGAAACAGTATTTTAGCCAGCACGAGCCAAGCCATCCCGCCCCGCTGATGATCG
AGCGCGTACAACGCATGATAGAGCTGGACTTTATGGACATTATCCGCGATCTCGCCCCGGACGGCGTACA
CCAGCTGGAAACGATTTTCGGGCGTCGCGACCACTCATAG