SecReT6
Protein ID: 188532764
SecReT6 ID285
T6SS typei3
Gene symbol-
Locus tagETA_06170
StrainErwinia tasmaniensis Et1/99
Repliconchromosome [GenBank: NC_010694] [Browse all T6SS(s) in this replicon]
Location [Strand]680650..681186 [+]
Producthypothetical protein
NoteTssB
UniProt IDB2VH75
KEGG IDeta:ETA_06170
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.00E-58, Aligned region: 12..162
Protein Sequence: 178 a.a.     [Download]
>gi|188532764|ref|YP_001906561.1| hypothetical protein ETA_06170 [Erwinia tasmaniensis Et1/99]
MAVSKSSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVMSDLVGKPLEAQPGVDERKFLDIDVDN
FDERMKALKPRVAFQAENTLTGEGRLNIDLTFNSMEDFSPDAVARNVEPLNQLLDARTQLANLLTYMDGK
NGAEELIGKILQDPTLLKSLSHLPKADDAPADDHGNKE
 
Nucleotide Sequence: 537 bp     [Download]
>gi|188532165|ref|NC_010694.1|:680650-681186 Erwinia tasmaniensis Et1/99 chromosome, complete genome
ATGGCAGTCAGTAAATCCAGTGGGCAAAAATTCATTGCCCGTAACCGCGCACCACGCGTGCAGATTGAGT
ACGACGTGGAAATCTATGGTGCGGAACGCAAAATCCAGCTGCCCTTCGTGATGGGCGTGATGTCCGACCT
GGTCGGCAAACCGCTGGAGGCGCAGCCGGGCGTCGATGAACGTAAGTTTCTTGACATCGACGTCGACAAC
TTCGACGAACGCATGAAGGCGCTGAAGCCCCGCGTGGCGTTCCAGGCAGAAAACACCCTGACCGGCGAAG
GGCGTCTCAACATCGATCTGACCTTCAACAGCATGGAAGACTTCTCGCCGGATGCGGTGGCACGCAACGT
CGAGCCGCTTAACCAGCTGCTGGATGCCCGCACCCAGCTGGCTAACCTGCTGACCTATATGGACGGCAAG
AACGGCGCGGAAGAGCTGATTGGCAAAATCCTCCAGGATCCAACGCTGCTGAAATCACTCAGCCATCTGC
CGAAAGCTGACGATGCGCCAGCCGACGACCACGGCAACAAGGAGTAA