SecReT6
Protein ID: 188532773
SecReT6 ID285
T6SS typei3
Gene symbol-
Locus tagETA_06260
StrainErwinia tasmaniensis Et1/99
Repliconchromosome [GenBank: NC_010694] [Browse all T6SS(s) in this replicon]
Location [Strand]686982..688811 [+]
ProductForkhead-associated (FHA) protein
NoteFha
UniProt IDB2VJE7
KEGG IDeta:ETA_06260
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 6.30E-08, Aligned region: 27..94
UreE_N [PF02814], Evalue: 0.0027, Aligned region: 30..49
UreE_N [PF02814], Evalue: 0.0027, Aligned region: 78..99
Protein Sequence: 609 a.a.     [Download]
>gi|188532773|ref|YP_001906570.1| Forkhead-associated (FHA) protein [Erwinia tasmaniensis Et1/99]
MRFTIITSKPGQQPPQSSCDFLPPGGTIGRGADNNLVLPDDDRTISRLQAIVHISATGECHITNRGNVTR
VHLNDIPLERGRQVELQDGDIIGIDDYRLQVSELSAAALPLSQPVSAPAVTRPQPVAAPVAPAAAAAPAA
IPSEIWDSLAQEFSISDNLSSRSKAKPPGQDNPLTAPAAAERNPADPLAQLKQNSDPLNLDRRDRTPDSL
FNQDPLFKQDSIFDDSTPSTLFQPPGAKSSVTHDARGDEQDPLALFGAGAAAQVDRDDPLGLMMGSAVPL
TPPEDKPQPGSQPPVSTPAPEPVPPAGGKKASSEQEDLPQPDSDFSLFGDDKTPQSGEASSPLFDVPPAA
AAQPTASSSSADYGGITLPTPQARARSSTPPPKGRLSIDPVANSAAHSSDGGGEMLDGDLMAALIGGMGL
QDLQPTPRFDQHAMQELGQMLSMFSQGTVALLSSRSILKRGVKAEMTVILDEANNPFKLLPSGKSVLMQM
FGSRMPGFMPPKQSVRDALVDLQAHQLGMIAGIRALIASMLQSFNPQQLEEEARQQGVTSRLSLPGSRKA
ALWDHFSKRYSETAGEIEDDFHTLFGEAFLHAYDMEVNQYKDSQIRSEE
 
Nucleotide Sequence: 1830 bp     [Download]
>gi|188532165|ref|NC_010694.1|:686982-688811 Erwinia tasmaniensis Et1/99 chromosome, complete genome
ATGCGATTTACGATTATAACGAGCAAACCGGGCCAGCAGCCGCCGCAGAGCAGCTGCGACTTTCTGCCGC
CCGGCGGCACTATTGGCCGTGGAGCCGATAACAACCTGGTGCTGCCGGATGACGACCGCACCATTTCACG
CCTTCAGGCTATCGTACATATCAGCGCGACGGGCGAGTGCCACATCACCAATCGTGGCAACGTGACGCGC
GTCCACCTGAATGATATTCCGCTGGAGCGCGGTCGCCAGGTCGAGCTCCAGGATGGCGATATCATCGGTA
TTGATGACTATCGCCTACAGGTCAGCGAACTGAGCGCCGCCGCGCTGCCGCTCAGTCAGCCGGTGTCCGC
GCCCGCAGTGACGCGCCCGCAGCCGGTCGCCGCGCCGGTCGCTCCGGCGGCAGCTGCTGCACCCGCAGCG
ATCCCCAGCGAGATCTGGGACAGCCTGGCGCAGGAGTTCTCGATTTCCGATAACCTCTCCAGCCGCAGCA
AAGCCAAACCGCCAGGCCAGGATAACCCGCTGACCGCTCCGGCCGCCGCCGAGCGCAACCCTGCCGATCC
GCTGGCACAGCTGAAGCAGAACAGCGATCCGTTAAACCTCGATCGCCGCGATCGAACTCCCGACAGCCTG
TTTAATCAGGATCCGCTGTTTAAACAGGACAGTATTTTTGATGACAGTACCCCCAGCACGCTGTTCCAGC
CGCCGGGAGCCAAAAGCAGCGTCACGCATGACGCACGAGGGGATGAGCAGGATCCGCTGGCGCTGTTCGG
CGCAGGCGCGGCGGCACAGGTCGATCGTGACGATCCGCTTGGCCTGATGATGGGCAGCGCGGTGCCGTTG
ACGCCGCCAGAGGATAAGCCGCAGCCGGGATCGCAGCCGCCGGTTAGCACGCCAGCGCCAGAACCCGTGC
CGCCTGCCGGCGGGAAAAAAGCCTCCTCCGAACAGGAAGATCTGCCGCAGCCGGACAGTGATTTCAGCCT
GTTTGGCGACGACAAAACGCCGCAGTCCGGTGAAGCCAGCTCGCCGCTGTTTGACGTGCCGCCAGCGGCT
GCGGCCCAGCCCACGGCGTCCTCCTCCAGCGCTGACTACGGCGGTATTACCCTGCCGACCCCGCAGGCGC
GTGCGCGCAGCAGCACTCCGCCACCGAAAGGGCGGCTCAGTATCGATCCGGTGGCGAACAGCGCCGCGCA
CAGCAGCGACGGCGGTGGTGAAATGCTGGACGGCGATCTGATGGCGGCGCTGATCGGCGGGATGGGGCTA
CAGGATCTGCAACCTACCCCGCGCTTCGATCAGCATGCGATGCAGGAGCTGGGGCAGATGCTCAGCATGT
TCTCACAGGGCACCGTAGCGCTGCTCTCTTCACGATCGATCCTCAAGCGCGGCGTCAAAGCGGAAATGAC
GGTGATCCTCGACGAGGCCAACAACCCGTTCAAGCTGCTGCCGTCCGGCAAATCGGTGCTGATGCAGATG
TTTGGCAGCCGCATGCCGGGCTTTATGCCGCCCAAGCAGTCGGTGCGCGATGCGCTGGTCGATTTACAGG
CGCACCAGCTGGGGATGATCGCCGGTATCCGGGCGCTGATCGCCTCGATGCTGCAATCGTTTAACCCGCA
GCAGCTGGAGGAGGAGGCGCGTCAGCAGGGCGTCACCTCGCGTCTGTCGCTGCCGGGCAGCCGCAAGGCG
GCATTGTGGGACCACTTCAGCAAACGCTATAGCGAGACTGCCGGTGAGATTGAAGATGACTTCCATACGC
TGTTCGGCGAAGCCTTCCTGCACGCCTACGATATGGAAGTCAACCAGTACAAAGACTCACAGATCAGATC
GGAAGAATGA