SecReT6
Protein ID: 188532776
SecReT6 ID285
T6SS typei3
Gene symbol-
Locus tagETA_06290
StrainErwinia tasmaniensis Et1/99
Repliconchromosome [GenBank: NC_010694] [Browse all T6SS(s) in this replicon]
Location [Strand]690640..691461 [+]
Producthypothetical protein
NoteTagJ
UniProt IDB2VJF0
KEGG IDeta:ETA_06290
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 1.20E-39, Aligned region: 143..266
Protein Sequence: 273 a.a.     [Download]
>gi|188532776|ref|YP_001906573.1| hypothetical protein ETA_06290 [Erwinia tasmaniensis Et1/99]
MHSLHHLMDGQSLAETLASLESQIKRQPADADLRASFVQLLCLAGNWSRAQTQLKSWLALKPQAQPTVTL
LEQAINGERQRAAVFAGEAAPRMPGAAWGWAEQLLAALAADAAGDTARAQQLRAAALDEAQLNPGQLTHQ
NQQHAFDWLTDGDGRLGPICELIANGQYSWLPFSAISEMRFQAPVSVTDLVWRHTLVRLVDGSEQVCQIP
VRYPFGEQADDRYRLATLTEWQPLAGDDPQFSGHGQKCWFSADAEFPLLGMETLAFSEAEPGL
 
Nucleotide Sequence: 822 bp     [Download]
>gi|188532165|ref|NC_010694.1|:690640-691461 Erwinia tasmaniensis Et1/99 chromosome, complete genome
ATGCACTCTCTACACCATCTGATGGACGGCCAGTCGCTGGCCGAAACCCTGGCGAGCCTCGAAAGCCAGA
TTAAACGCCAGCCCGCCGATGCCGATCTGCGCGCCAGCTTTGTCCAGCTGCTGTGCCTGGCGGGCAACTG
GAGCCGGGCGCAGACCCAGCTGAAAAGCTGGCTTGCGCTGAAGCCGCAGGCACAGCCCACGGTGACGCTG
CTGGAGCAGGCAATTAACGGCGAACGCCAGCGCGCGGCGGTATTCGCCGGTGAAGCCGCGCCACGGATGC
CGGGAGCGGCCTGGGGTTGGGCAGAGCAACTGCTTGCAGCGCTGGCGGCCGATGCCGCAGGCGACACTGC
CCGGGCGCAGCAGTTGCGCGCCGCCGCCTTAGACGAGGCGCAGCTCAATCCCGGCCAGCTTACGCACCAG
AACCAGCAGCACGCCTTTGACTGGCTGACCGACGGTGACGGGCGGCTCGGCCCGATCTGTGAACTGATTG
CCAACGGACAGTACAGCTGGCTGCCGTTCAGCGCCATCAGCGAAATGCGCTTTCAGGCACCGGTCAGCGT
CACCGACTTGGTATGGCGGCATACGCTGGTCAGGCTGGTGGATGGCAGCGAGCAGGTGTGCCAGATCCCG
GTACGCTATCCGTTCGGCGAACAGGCCGACGACCGCTACCGCCTGGCCACGCTCACCGAATGGCAGCCGC
TGGCGGGCGACGACCCGCAGTTCAGCGGCCACGGTCAGAAATGCTGGTTCAGCGCCGATGCCGAATTCCC
GCTGCTGGGCATGGAGACGCTGGCGTTTAGCGAAGCAGAGCCAGGCTTATGA