SecReT6
Protein ID: 188532777
SecReT6 ID285
T6SS typei3
Gene symbol-
Locus tagETA_06300
StrainErwinia tasmaniensis Et1/99
Repliconchromosome [GenBank: NC_010694] [Browse all T6SS(s) in this replicon]
Location [Strand]691458..692024 [+]
Producthypothetical protein
NoteTssE
UniProt IDB2VJF1
KEGG IDeta:ETA_06300
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.00E-18, Aligned region: 57..167
Protein Sequence: 188 a.a.     [Download]
>gi|188532777|ref|YP_001906574.1| hypothetical protein ETA_06300 [Erwinia tasmaniensis Et1/99]
MSQHSDEGHKLLHGGYRQRRQQEGLNVRDKMQPSLLDRLTDHAPDNPREAANSTLISHSALRRNVLRDLQ
WLFNTINNEAQQDLSPFPHVQRSTVNFGIAPLAGQRMSDIEWQDIQRKLSAAILNFEPRILPAGLQVRCV
SDIGSLDLHNVLSIEIKGRLWCVPYPLEFLFRTDVDLENGHFALRDIG
 
Nucleotide Sequence: 567 bp     [Download]
>gi|188532165|ref|NC_010694.1|:691458-692024 Erwinia tasmaniensis Et1/99 chromosome, complete genome
ATGAGCCAGCACAGCGACGAGGGGCACAAGCTGCTGCACGGCGGTTACCGCCAGCGCCGCCAGCAGGAAG
GGCTGAACGTGCGCGACAAAATGCAGCCATCGCTGCTCGACCGCTTAACCGACCACGCGCCGGACAACCC
GCGTGAAGCGGCGAACAGCACCCTGATCTCGCACAGCGCGCTGCGGCGCAACGTGCTGCGCGATCTGCAA
TGGCTGTTTAATACCATTAACAATGAAGCGCAGCAGGATTTGTCGCCGTTCCCGCACGTGCAGCGCTCGA
CGGTGAACTTCGGCATTGCTCCGCTGGCGGGACAGCGCATGTCGGATATTGAATGGCAGGATATCCAGCG
CAAGTTGAGCGCGGCGATCCTCAACTTTGAACCGCGCATTCTGCCCGCCGGGTTACAGGTGCGCTGCGTG
TCCGACATCGGCTCGCTCGACCTGCACAACGTGCTGTCGATTGAGATCAAGGGCCGCCTGTGGTGCGTGC
CGTACCCGCTGGAGTTCCTGTTTCGTACCGATGTGGATCTGGAAAACGGCCACTTTGCTCTGCGCGATAT
CGGTTAA