SecReT6
Protein ID: 188532778
SecReT6 ID285
T6SS typei3
Gene symbol-
Locus tagETA_06310
StrainErwinia tasmaniensis Et1/99
Repliconchromosome [GenBank: NC_010694] [Browse all T6SS(s) in this replicon]
Location [Strand]692042..693916 [+]
Producthypothetical protein
NoteTssF
UniProt IDB2VJF2
KEGG IDeta:ETA_06310
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.30E-208, Aligned region: 6..624
Protein Sequence: 624 a.a.     [Download]
>gi|188532778|ref|YP_001906575.1| hypothetical protein ETA_06310 [Erwinia tasmaniensis Et1/99]
MDSKQLDYYNRELAYLREMGAEFAGRYPKVAGRLGIRGDEVADPYVERLMEGFAFLTSRVQLKMDAEFPR
FSQRLLEMIAPNYLSPTPSMAIAELQPDSRKGDISNGFLVPRGTMMDSQALKQNGVTCSYTTAHDVMLQP
VRIKSVELGGIPADVPLGELGLSQRGAVSALRIRIACDESVTLSHLSFDSLMFFLSGPDMQALQLLELVM
QHYVGGYCQSLGSSPQRTPLGDDALRQEGFAADQALLPNDLRNFDGYRLLQEYFAFPARFQFISIGQLRP
LLQACDPQAREFDIVLLLDSANPGLERVIDHSHLALHCTPVINLFPKVAQRQKLSDSVHEYHLVVDNIRP
LDYEIYSVQKLYASGERQREEQQFRPFWSTFSDDGGNYGAYFSLRREQRTLSERAQRFGTRTGYVGSEVF
LSLVDEHNSPWHEDLRYLTAEVMCTSRDLPLLLLQQQGQFVMPDSIPVRQLTLRKGPTPPRPALAEGKIA
WRLVSHLQMNYLSLMDGDDGQGAAALRQMLGLYANLAEAAAARQIDGIRHCQLKPVFRRVPEPGPIVFAR
GIGIELEVDEQAFSGSSPWLLGSVLERVFSRLVAINTFTEMTLTSQQRGDVGYWAPRMGKRTLI
 
Nucleotide Sequence: 1875 bp     [Download]
>gi|188532165|ref|NC_010694.1|:692042-693916 Erwinia tasmaniensis Et1/99 chromosome, complete genome
ATGGACAGTAAGCAGCTCGACTATTACAACCGTGAGCTGGCGTATCTGCGCGAAATGGGCGCGGAGTTTG
CCGGGCGCTATCCGAAGGTGGCTGGCCGACTCGGCATACGTGGCGACGAGGTCGCCGATCCCTACGTTGA
GCGGCTGATGGAGGGCTTTGCCTTTCTTACCTCCCGCGTGCAGCTGAAAATGGACGCCGAGTTTCCGCGT
TTCTCCCAGCGCCTGCTGGAGATGATTGCGCCGAACTACCTGTCGCCAACGCCGTCGATGGCGATTGCCG
AACTGCAGCCGGACAGCCGTAAAGGGGATATCAGCAACGGTTTTCTGGTGCCGCGCGGCACCATGATGGA
CAGCCAGGCGTTGAAGCAGAATGGCGTCACCTGTAGCTACACCACCGCCCATGACGTGATGCTGCAACCG
GTGCGCATCAAAAGCGTCGAGCTGGGCGGCATTCCGGCCGACGTGCCGCTCGGCGAGCTGGGGCTAAGCC
AGCGCGGCGCGGTCAGCGCCTTGCGTATTCGTATTGCCTGTGATGAGAGCGTCACGCTTTCCCATCTCAG
CTTTGACAGCCTGATGTTCTTTCTTAGCGGGCCGGATATGCAGGCGCTGCAACTGCTGGAGCTGGTGATG
CAGCACTACGTGGGCGGCTATTGCCAGAGCCTGGGCAGCAGCCCGCAGCGCACGCCGCTGGGTGATGATG
CGCTACGGCAGGAGGGGTTTGCGGCAGATCAGGCGCTGCTGCCAAACGATCTGCGCAACTTCGATGGTTA
TCGTCTGTTGCAGGAGTATTTCGCCTTCCCGGCGCGCTTCCAGTTTATCAGCATCGGCCAGCTGCGCCCG
CTGCTCCAGGCCTGTGACCCGCAGGCGCGCGAATTCGATATCGTGCTGCTGCTGGACAGCGCCAACCCAG
GCCTGGAGCGGGTGATTGACCACAGCCATCTGGCGCTGCACTGCACCCCGGTGATTAACCTGTTTCCAAA
GGTGGCGCAGCGGCAAAAGCTCAGCGACAGCGTGCACGAATACCACCTGGTGGTGGATAACATCCGTCCG
CTGGACTACGAAATTTACTCGGTGCAGAAGCTGTACGCCAGCGGCGAGCGCCAGCGCGAGGAGCAGCAGT
TTCGCCCATTCTGGAGCACCTTCAGCGATGACGGCGGCAACTACGGGGCCTATTTCTCGCTGCGGCGCGA
ACAGCGCACCCTGTCCGAGCGTGCGCAGCGCTTTGGTACGCGCACAGGTTATGTGGGTTCGGAAGTGTTT
CTTTCGCTGGTGGATGAGCACAACTCGCCGTGGCATGAAGATTTGCGCTATCTCACCGCCGAGGTGATGT
GCACCAGCCGCGACCTGCCGTTACTGCTGCTGCAACAGCAGGGGCAGTTTGTGATGCCTGATTCGATCCC
GGTGCGCCAGCTGACGCTGCGTAAAGGGCCAACCCCGCCGCGCCCGGCGCTGGCGGAGGGGAAAATCGCC
TGGCGGCTGGTCAGTCACCTGCAAATGAACTATCTCAGCCTGATGGACGGCGACGACGGCCAGGGCGCGG
CGGCGCTGCGCCAGATGCTCGGGCTGTATGCCAACCTCGCTGAAGCCGCCGCGGCGCGCCAGATCGACGG
CATTCGCCACTGCCAGCTCAAGCCGGTGTTCCGGCGCGTGCCGGAGCCAGGCCCGATAGTCTTTGCCCGT
GGCATCGGCATTGAGCTGGAGGTGGACGAGCAGGCGTTTTCTGGCAGCAGCCCGTGGCTACTCGGCAGCG
TGCTGGAGCGGGTGTTCTCACGTCTGGTGGCGATCAACACCTTTACCGAAATGACGCTCACCAGCCAGCA
GCGCGGGGATGTCGGCTACTGGGCGCCACGCATGGGCAAAAGGACACTGATATGA