SecReT6
Protein ID: 188532779
SecReT6 ID285
T6SS typei3
Gene symbol-
Locus tagETA_06320
StrainErwinia tasmaniensis Et1/99
Repliconchromosome [GenBank: NC_010694] [Browse all T6SS(s) in this replicon]
Location [Strand]693913..694971 [+]
Producthypothetical protein
NoteTssG
UniProt IDB2VJF3
KEGG IDeta:ETA_06320
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.60E-109, Aligned region: 28..332
Protein Sequence: 352 a.a.     [Download]
>gi|188532779|ref|YP_001906576.1| hypothetical protein ETA_06320 [Erwinia tasmaniensis Et1/99]
MTQQPAAQAEKIHRLHRLPPDFWAALCATPWRYDLFQLLRRLDAQGGQRYPLGRAPLPRHEPLRIGQRPS
LAFAPAAIASVTPRDGSALHDVSIYSFGLFGPNGPLPVHLTEYARERSDHHQDNSLSAFTDLFHHRLTLL
FYRAWADAQPTVALDRAEKRQFERWLASLIGMGQPGQLRQGSLSPHSRLALAGHLTRQARDAEGLQKILS
HYFQVPVRLVENVPHWQPVDRRDRASLGAGRHKPRLGVSAFLGVAVRDVQHKFRLELGPLSMDSYRRFLP
GEPWAQQLRDWVRQYLGIEFLWEVRLILDAAEVQGVTLGGASRLGYSSWLGRPAIPQHRSDLTFSPEPQE
SV
 
Nucleotide Sequence: 1059 bp     [Download]
>gi|188532165|ref|NC_010694.1|:693913-694971 Erwinia tasmaniensis Et1/99 chromosome, complete genome
ATGACGCAGCAGCCCGCCGCGCAGGCGGAGAAGATCCACCGCCTGCATCGTCTGCCGCCGGACTTCTGGG
CGGCGCTGTGCGCCACGCCGTGGCGCTACGATTTGTTCCAGCTGCTGCGGCGGCTGGATGCGCAGGGCGG
CCAGCGCTATCCGCTGGGGCGTGCGCCGCTGCCGCGCCACGAGCCGCTGCGCATCGGACAGCGGCCGTCA
CTGGCCTTTGCCCCGGCGGCCATCGCCAGCGTCACGCCGCGTGACGGCAGCGCGCTGCACGATGTGTCGA
TCTACAGCTTTGGCCTGTTTGGCCCCAACGGCCCGCTGCCCGTCCATCTCACGGAATATGCGCGTGAGCG
CAGCGACCACCATCAGGACAACAGCCTCAGTGCCTTTACCGATCTGTTCCACCATCGCCTGACGCTGCTG
TTTTACCGCGCCTGGGCCGATGCGCAGCCCACGGTGGCGCTGGACAGGGCGGAAAAACGTCAGTTTGAGC
GCTGGCTCGCCAGCCTGATCGGCATGGGGCAGCCGGGGCAGCTCAGGCAGGGCAGCCTTAGCCCGCATTC
ACGCCTGGCGCTGGCCGGGCATCTGACCCGACAGGCGCGCGATGCCGAGGGGCTGCAAAAAATTCTCAGC
CACTACTTTCAGGTGCCGGTGCGGCTGGTGGAAAACGTTCCCCACTGGCAGCCGGTCGATCGCCGCGACC
GCGCCAGCCTGGGGGCCGGGCGGCACAAGCCGCGACTCGGCGTGTCGGCGTTTCTCGGCGTGGCGGTGCG
CGACGTGCAGCACAAGTTTCGTCTGGAGCTGGGGCCGCTATCGATGGACAGCTACCGGCGCTTTCTGCCC
GGCGAACCCTGGGCGCAGCAGCTGCGCGACTGGGTGCGTCAGTACCTGGGCATTGAGTTTCTCTGGGAGG
TGCGGCTTATTCTTGATGCCGCCGAGGTGCAGGGCGTCACCCTCGGCGGCGCATCGCGGCTGGGATACAG
CAGCTGGCTGGGACGGCCGGCTATCCCACAGCACCGCAGCGATCTCACCTTTAGCCCGGAGCCACAGGAA
AGTGTTTAG