SecReT6
Protein ID: 188532782
SecReT6 ID285
T6SS typei3
Gene symbol-
Locus tagETA_06350
StrainErwinia tasmaniensis Et1/99
Repliconchromosome [GenBank: NC_010694] [Browse all T6SS(s) in this replicon]
Location [Strand]696188..698803 [+]
ProductClpA/B-type chaperone
NoteTssH
UniProt IDB2VJF6
KEGG IDeta:ETA_06350
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.60E-40, Aligned region: 223..245
AAA_2 [PF07724], Evalue: 1.60E-40, Aligned region: 602..767
AAA [PF00004], Evalue: 1.60E-20, Aligned region: 223..355
AAA [PF00004], Evalue: 1.60E-20, Aligned region: 608..692
ClpB_D2-small [PF10431], Evalue: 3.50E-16, Aligned region: 775..850
AAA_5 [PF07728], Evalue: 5.40E-13, Aligned region: 223..300
AAA_5 [PF07728], Evalue: 5.40E-13, Aligned region: 348..372
AAA_5 [PF07728], Evalue: 5.40E-13, Aligned region: 607..728
AAA_16 [PF13191], Evalue: 3.10E-09, Aligned region: 33..82
AAA_16 [PF13191], Evalue: 3.10E-09, Aligned region: 200..243
AAA_16 [PF13191], Evalue: 3.10E-09, Aligned region: 268..302
AAA_16 [PF13191], Evalue: 3.10E-09, Aligned region: 604..652
AAA_16 [PF13191], Evalue: 3.10E-09, Aligned region: 672..689
AAA_22 [PF13401], Evalue: 2.90E-08, Aligned region: 223..303
AAA_22 [PF13401], Evalue: 2.90E-08, Aligned region: 371..389
AAA_22 [PF13401], Evalue: 2.90E-08, Aligned region: 606..631
AAA_22 [PF13401], Evalue: 2.90E-08, Aligned region: 669..690
Sigma54_activat [PF00158], Evalue: 4.50E-07, Aligned region: 217..239
Sigma54_activat [PF00158], Evalue: 4.50E-07, Aligned region: 607..723
AAA_14 [PF13173], Evalue: 1.50E-06, Aligned region: 223..313
AAA_14 [PF13173], Evalue: 1.50E-06, Aligned region: 329..390
AAA_14 [PF13173], Evalue: 1.50E-06, Aligned region: 606..717
AAA_25 [PF13481], Evalue: 3.60E-06, Aligned region: 217..247
AAA_25 [PF13481], Evalue: 3.60E-06, Aligned region: 276..320
AAA_25 [PF13481], Evalue: 3.60E-06, Aligned region: 598..629
NACHT [PF05729], Evalue: 1.20E-05, Aligned region: 223..259
NACHT [PF05729], Evalue: 1.20E-05, Aligned region: 608..634
AAA_19 [PF13245], Evalue: 1.50E-05, Aligned region: 222..247
AAA_19 [PF13245], Evalue: 1.50E-05, Aligned region: 380..400
AAA_19 [PF13245], Evalue: 1.50E-05, Aligned region: 605..629
AAA_17 [PF13207], Evalue: 3.90E-05, Aligned region: 223..243
AAA_17 [PF13207], Evalue: 3.90E-05, Aligned region: 607..643
IstB_IS21 [PF01695], Evalue: 4.20E-05, Aligned region: 216..242
IstB_IS21 [PF01695], Evalue: 4.20E-05, Aligned region: 607..627
IstB_IS21 [PF01695], Evalue: 4.20E-05, Aligned region: 718..739
Zeta_toxin [PF06414], Evalue: 5.10E-05, Aligned region: 223..243
Zeta_toxin [PF06414], Evalue: 5.10E-05, Aligned region: 601..657
Zeta_toxin [PF06414], Evalue: 5.10E-05, Aligned region: 782..816
Clp_N [PF02861], Evalue: 0.00011, Aligned region: 28..75
Clp_N [PF02861], Evalue: 0.00011, Aligned region: 106..123
Clp_N [PF02861], Evalue: 0.00011, Aligned region: 310..320
AAA_29 [PF13555], Evalue: 0.00047, Aligned region: 215..239
AAA_29 [PF13555], Evalue: 0.00047, Aligned region: 605..632
AAA_18 [PF13238], Evalue: 0.00051, Aligned region: 223..242
AAA_18 [PF13238], Evalue: 0.00051, Aligned region: 609..632
AAA_18 [PF13238], Evalue: 0.00051, Aligned region: 796..857
FtsK_SpoIIIE [PF01580], Evalue: 0.00067, Aligned region: 196..266
FtsK_SpoIIIE [PF01580], Evalue: 0.00067, Aligned region: 465..517
FtsK_SpoIIIE [PF01580], Evalue: 0.00067, Aligned region: 606..625
RNA_helicase [PF00910], Evalue: 0.0024, Aligned region: 224..244
RNA_helicase [PF00910], Evalue: 0.0024, Aligned region: 608..629
RNA_helicase [PF00910], Evalue: 0.0024, Aligned region: 705..726
SRP54 [PF00448], Evalue: 0.0061, Aligned region: 222..243
SRP54 [PF00448], Evalue: 0.0061, Aligned region: 606..640
RuvB_N [PF05496], Evalue: 0.0075, Aligned region: 222..240
RuvB_N [PF05496], Evalue: 0.0075, Aligned region: 278..303
RuvB_N [PF05496], Evalue: 0.0075, Aligned region: 576..628
RuvB_N [PF05496], Evalue: 0.0075, Aligned region: 676..700
Arch_ATPase [PF01637], Evalue: 0.0086, Aligned region: 202..237
Arch_ATPase [PF01637], Evalue: 0.0086, Aligned region: 276..307
Arch_ATPase [PF01637], Evalue: 0.0086, Aligned region: 606..646
T2SE [PF00437], Evalue: 0.0091, Aligned region: 208..240
T2SE [PF00437], Evalue: 0.0091, Aligned region: 604..684
Protein Sequence: 871 a.a.     [Download]
>gi|188532782|ref|YP_001906579.1| ClpA/B-type chaperone [Erwinia tasmaniensis Et1/99]
MSEISRAVLFGKLDTLLFTSLESATAFCKLRGNPYVELVHWLHQLMQHQGGDLQQLIRHFSLDEEALTRD
IVAALDRLPRGASAVSDLSEHIDSAVERAWVYGSLKFGVQQIRGGHLLIGLLKTFNLANLLKSISPQFSR
VSVDVLLEQFERVFGDSKEAQQVSIAPQTASGEVPQQQGTLAQYAQDLTARARDGKIDPVAGRDPEIRQM
VDILMRRRQNNPLLTGEAGVGKTAVVEGLALRIAAGEVPEPLQQVQLWLLDIGMLQAGAGMKGEFEARLQ
ALINEVQSSPTPIVLFIDEIHTLVGAGGQQGTGDAANLLKPALARGQLRTIGATTWAEYKKYIEKDPALT
RRFQTVQVHEPDEEKALLMLRSTVSPLEQHHRVLLLDEAVAAAVRLSHRYIPARQLPDKAVALLDTACAR
VAVSQSAQPPQLEDCLHRIHALEIERDIAGREAKVGIGEAGRVTQLEQQLAALAEQRGSLNERWQQERAL
VDEIIALRGQLSAEAAEDEASLHRDLAERQQQLHELQGEAPLLFSAVDANVVAAVVADWTGIPLGRMVKN
EIDAVLKLADTLNQRVIGQRHGLDLIAKRVRTSRARLDDPNKPVGVFMLCGPSGVGKTETALALAETLYG
GEQNIITINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKAHPDVHEIFFQVF
DKGWMEDGEGRHIDFRNTIIILTSNVGTQLISAMCADPELIPQPDDLAAALRPPLLEVFPPALLGRLLVV
PYYPLNDEVLANIVRLQLQRIQRRLEENHGIISEVDDSVISQIVQRCTEVESGGRMVDAILTNTLLPQMS
QMLLSASARDEQYRRLRVTLHQGEFQCQFEA
 
Nucleotide Sequence: 2616 bp     [Download]
>gi|188532165|ref|NC_010694.1|:696188-698803 Erwinia tasmaniensis Et1/99 chromosome, complete genome
ATGTCAGAAATCAGCCGCGCCGTACTGTTCGGCAAACTGGATACGCTGTTATTTACCTCTCTGGAGAGCG
CCACCGCGTTTTGTAAACTGCGCGGCAACCCCTATGTGGAGCTGGTGCACTGGCTGCATCAGCTGATGCA
GCATCAGGGCGGTGACCTACAGCAGCTTATCCGCCATTTTTCACTGGATGAAGAGGCGCTGACGCGGGAT
ATCGTGGCGGCGCTCGACAGGCTGCCGCGCGGAGCCAGCGCGGTCTCTGACCTGTCCGAACATATCGACA
GCGCGGTGGAACGCGCCTGGGTTTACGGCTCGCTGAAGTTCGGCGTACAGCAGATCCGCGGCGGCCACCT
GCTGATCGGCCTGTTGAAAACCTTCAATCTCGCCAACCTGCTGAAAAGCATCTCGCCGCAGTTCAGCCGC
GTCAGCGTTGACGTGCTGCTGGAGCAGTTTGAGCGGGTGTTTGGCGACAGCAAAGAAGCTCAGCAGGTCA
GCATCGCGCCGCAGACCGCCAGCGGCGAGGTGCCGCAGCAGCAGGGAACCCTGGCGCAGTACGCCCAGGA
CCTGACGGCGCGCGCGCGCGATGGCAAGATCGATCCGGTGGCCGGGCGCGACCCGGAGATCCGCCAGATG
GTGGATATTCTGATGCGCCGTCGCCAAAACAACCCGCTACTCACCGGGGAAGCCGGGGTAGGCAAAACGG
CGGTGGTGGAAGGGCTGGCGCTGCGTATCGCCGCTGGCGAGGTGCCTGAACCGCTGCAACAGGTGCAGCT
GTGGCTGCTGGATATCGGCATGCTGCAGGCCGGAGCCGGCATGAAGGGCGAATTTGAGGCGCGGCTTCAG
GCGCTAATTAATGAAGTACAGTCCAGTCCAACGCCGATCGTCCTGTTTATCGACGAGATCCACACCCTGG
TCGGCGCGGGCGGTCAGCAGGGCACAGGCGATGCCGCCAACCTGCTGAAACCGGCGCTGGCACGCGGTCA
GCTGCGCACCATCGGTGCCACCACCTGGGCGGAGTACAAAAAGTACATTGAGAAAGACCCGGCGCTGACC
CGCCGCTTCCAGACCGTGCAGGTGCACGAGCCGGACGAGGAGAAAGCGCTGCTGATGCTGCGCAGCACCG
TCAGCCCGCTGGAACAGCACCATCGGGTGCTGCTGTTGGACGAGGCCGTTGCGGCGGCGGTCAGGCTCTC
CCATCGCTATATTCCGGCGCGTCAGCTGCCGGATAAGGCGGTGGCGCTGCTGGACACCGCCTGTGCGCGC
GTTGCCGTCAGCCAGAGCGCCCAGCCGCCGCAGCTGGAAGACTGCCTGCATCGTATTCACGCGCTGGAGA
TTGAGCGCGATATCGCCGGGCGCGAGGCGAAAGTCGGCATCGGCGAGGCCGGGCGTGTGACGCAGCTGGA
ACAGCAGCTGGCGGCGCTTGCTGAACAGCGCGGCAGTCTCAATGAGCGCTGGCAGCAGGAGCGCGCGCTG
GTGGACGAGATTATCGCCCTGCGCGGGCAGCTAAGCGCAGAGGCGGCGGAAGACGAGGCGAGCCTGCATC
GTGATCTTGCCGAACGCCAGCAGCAGCTGCATGAACTGCAGGGCGAAGCCCCGCTGCTGTTTTCGGCGGT
GGATGCCAACGTGGTGGCGGCGGTGGTCGCCGACTGGACCGGCATTCCGCTGGGGCGCATGGTGAAAAAC
GAAATCGACGCGGTGCTTAAGCTGGCGGATACCCTTAACCAGCGGGTGATCGGCCAGCGCCACGGCCTTG
ACCTGATTGCCAAACGGGTACGCACCTCGCGCGCGCGTCTTGATGACCCCAACAAGCCGGTCGGGGTCTT
TATGCTGTGCGGGCCATCCGGGGTGGGTAAAACCGAAACCGCGCTGGCGCTGGCGGAAACCCTGTACGGC
GGCGAACAGAATATTATCACCATCAATATGAGCGAGTTCCAGGAGGCGCACACCGTTTCCACCCTGAAGG
GCGCACCGCCGGGCTACGTGGGCTACGGCGAAGGCGGCGTTCTGACCGAAGCGGTGCGCCGCCGCCCGTA
CAGCGTTGTGCTGCTGGATGAAATTGAAAAGGCGCACCCGGACGTGCATGAGATCTTCTTCCAGGTGTTT
GACAAGGGGTGGATGGAGGATGGCGAAGGGCGGCATATCGATTTCCGCAACACTATCATTATCCTCACTT
CTAACGTCGGTACGCAGCTGATTAGCGCCATGTGTGCCGACCCGGAACTGATCCCGCAGCCGGACGATCT
GGCCGCTGCGCTGCGCCCGCCGCTGCTGGAGGTGTTCCCTCCCGCCCTGCTGGGCCGCCTGCTGGTGGTG
CCTTACTATCCGCTCAATGATGAGGTGCTGGCCAATATCGTGCGTCTGCAACTTCAGCGTATTCAGCGGC
GGCTCGAGGAGAATCACGGTATCATCTCCGAAGTGGATGACAGCGTGATTAGCCAGATTGTTCAGCGCTG
TACCGAAGTGGAGTCCGGCGGCCGTATGGTCGACGCCATTCTTACCAATACCCTGTTGCCGCAAATGAGC
CAGATGCTGCTGTCTGCCAGCGCGCGCGACGAACAATACCGTCGCCTGCGCGTTACGTTACACCAGGGCG
AATTCCAGTGTCAGTTTGAGGCGTAA