SecReT6
Protein ID: 188532784
SecReT6 ID285
T6SS typei3
Gene symbol-
Locus tagETA_06370
StrainErwinia tasmaniensis Et1/99
Repliconchromosome [GenBank: NC_010694] [Browse all T6SS(s) in this replicon]
Location [Strand]700286..702910 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDB2VH54
KEGG IDeta:ETA_06370
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.40E-71, Aligned region: 22..327
Phage_base_V [PF04717], Evalue: 2.10E-25, Aligned region: 366..459
Protein Sequence: 874 a.a.     [Download]
>gi|188532784|ref|YP_001906581.1| Rhs element Vgr protein [Erwinia tasmaniensis Et1/99]
MFDRITVQLPMDGLLFWRLSGREALSQSFELSVQLLSTDARIERKALLGQPIVISIPTQGITSTRYLNGK
ITKVSVSSLELGGTRYAVYTLMMEPDLWPLKRDKNLRIFQGQTVPQIVKTLLGEYNVRLEDRLTGSYRSW
EYCVQYQESSFNFISRLMELEGIYYYFRHEADGHTLVLMDAAQQHQPFSGYEAIPYHVTPSGGSTSAEGI
GLWSLEDSVTPGMYSIDDYDFRKPNAWMLQARQNPASPQPGAIDVYDWPGHFVDHDHGEFYTRIRQQVWQ
VEHQQIGAAGTALGLAPGHTFTVLNAPFISDNGEYLTTEAYYDFEENQYASGDGAGGTKHNIAVRVIPSA
VTFRAQPETPWPRTHGPQTAKVVGPKGESIWTDKYGRIKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGYG
GVQIPRVGDEVVVDFINGDPDRPIITGRVYNEASMPPWALPAAATQMGFMSRSKDGTPDNANALRFEDKA
GAEQVWIQAERNMDTQVKNDASHSVGKNHSHYVGESELHRVETDRVHGIKGAEQLLTGKGKSDAAAETYV
IGSGTTLRLECGESAIELTAGGQINIVGKGFNFCVEQDGFINTGGKLNLNDGSAAATAAPGSSHKANITS
AVEALFPAKKGSKQGTAVKKSPPSSSDTESHRRGDLSMKYETGRRPGQYAQAAATVSSGRGDPGGKSYGA
YQLASSAKGGHQVQKFLQNEGAKWTKEFSGMNPEKSGSFESKWKEIANSQPDEMFNAQHAFIERTHFKPA
LEKVLDSTGVDLSLRSAAVQDVAWSTSVQHGKAAEMLTQAVNEVKATTPVDNVNFDREFINQLYSNRTDY
VNSLSKLNEKTKSGLVNRYLDEKNSAFKMLTDRI
 
Nucleotide Sequence: 2625 bp     [Download]
>gi|188532165|ref|NC_010694.1|:700286-702910 Erwinia tasmaniensis Et1/99 chromosome, complete genome
ATGTTTGACCGTATCACCGTACAGCTGCCGATGGACGGGCTGCTGTTCTGGCGTCTTAGTGGACGCGAAG
CGCTGTCGCAGTCATTTGAGCTGAGCGTGCAGCTGTTAAGCACCGACGCGCGCATCGAGCGCAAGGCGCT
GCTCGGCCAGCCGATCGTCATCTCCATCCCCACCCAGGGGATAACGAGCACCCGCTACCTGAATGGTAAA
ATCACCAAAGTCTCGGTCAGCAGCCTGGAGCTGGGCGGCACGCGCTATGCGGTGTATACCCTGATGATGG
AGCCGGACCTGTGGCCGCTGAAACGGGATAAAAACCTGCGTATTTTCCAGGGGCAGACGGTGCCGCAGAT
CGTCAAAACCCTGCTCGGCGAGTACAACGTCAGGCTGGAAGACCGCCTGACCGGCAGCTACCGCAGCTGG
GAGTACTGCGTGCAGTACCAGGAGAGCAGCTTTAACTTTATCAGCCGGCTGATGGAGCTGGAGGGGATCT
ATTACTACTTCCGCCACGAGGCGGACGGGCACACGCTGGTGCTGATGGACGCGGCGCAGCAGCACCAGCC
GTTCAGCGGCTACGAGGCGATCCCTTACCACGTCACGCCGTCCGGCGGCAGCACCAGCGCAGAGGGCATC
GGGCTGTGGTCGCTGGAGGACAGCGTCACGCCGGGGATGTACAGCATCGACGACTACGACTTCCGCAAGC
CGAACGCGTGGATGCTCCAGGCGCGGCAGAATCCGGCCTCGCCGCAGCCGGGGGCCATCGACGTCTACGA
CTGGCCGGGCCACTTTGTTGACCACGATCACGGCGAGTTCTACACGCGCATCCGCCAGCAGGTGTGGCAG
GTGGAGCACCAGCAGATCGGTGCCGCCGGTACCGCGCTGGGGCTGGCGCCGGGCCATACCTTTACGGTGC
TGAACGCGCCGTTTATCAGCGATAACGGCGAGTACCTGACTACCGAGGCGTACTACGATTTTGAAGAGAA
TCAGTACGCCAGCGGTGACGGAGCCGGCGGAACAAAACACAATATCGCCGTCCGCGTGATCCCCTCCGCC
GTGACGTTCCGCGCGCAGCCGGAAACGCCGTGGCCGCGCACCCACGGACCGCAGACGGCGAAGGTAGTGG
GGCCGAAGGGCGAGTCGATCTGGACCGATAAATATGGCCGCATCAAGGTGAAGTTTCACTGGGATCGGCT
GGCGAAGGGCGACGACACCAGCTCGTGCTGGGTGCGCGTTTCCAGCGCCTGGGCGGGTCAGGGCTACGGC
GGTGTGCAGATCCCGCGCGTGGGCGACGAGGTGGTCGTCGACTTTATCAACGGCGATCCGGACCGGCCAA
TCATCACCGGGCGCGTGTACAACGAGGCGAGCATGCCGCCGTGGGCGCTGCCGGCCGCCGCGACGCAGAT
GGGCTTTATGAGCCGCTCGAAGGACGGCACGCCGGACAACGCTAACGCGCTGCGCTTCGAGGATAAGGCG
GGCGCGGAGCAGGTGTGGATCCAGGCCGAGCGCAATATGGACACCCAGGTGAAGAATGACGCCAGCCACA
GCGTGGGTAAAAACCACAGTCATTACGTTGGAGAAAGTGAGCTGCACCGGGTAGAGACCGATCGCGTGCA
CGGCATTAAGGGGGCTGAACAGCTGCTAACCGGCAAAGGGAAAAGCGATGCGGCGGCAGAAACCTACGTG
ATTGGTTCCGGCACCACGCTGCGCCTGGAGTGCGGTGAAAGCGCCATTGAACTAACCGCCGGCGGGCAGA
TCAATATTGTGGGCAAGGGCTTTAATTTCTGCGTGGAACAGGATGGCTTTATCAATACCGGCGGTAAGCT
GAATCTGAATGACGGTAGCGCGGCAGCGACCGCCGCGCCGGGCTCATCCCATAAAGCAAATATTACCAGT
GCCGTGGAGGCGCTGTTCCCGGCAAAAAAGGGGAGTAAGCAAGGGACGGCGGTAAAAAAATCACCACCTT
CTTCTTCGGATACAGAAAGCCACCGGCGTGGCGACCTTTCAATGAAATATGAGACCGGAAGACGTCCAGG
CCAATATGCTCAGGCTGCGGCAACTGTCTCATCCGGGAGAGGAGATCCTGGAGGTAAGTCTTATGGTGCT
TATCAGCTTGCATCTTCAGCTAAAGGTGGACATCAGGTGCAGAAGTTTTTGCAAAATGAAGGCGCAAAGT
GGACTAAAGAGTTCAGTGGTATGAATCCCGAAAAGTCCGGCTCTTTTGAGAGTAAATGGAAAGAAATTGC
TAACAGTCAACCTGACGAGATGTTCAATGCGCAACATGCTTTTATTGAGCGAACACACTTTAAGCCAGCA
CTTGAAAAAGTTTTAGATAGTACGGGTGTTGACCTTTCGTTGAGGAGTGCTGCCGTACAGGACGTTGCAT
GGTCGACATCTGTCCAGCATGGTAAAGCGGCGGAAATGCTGACTCAAGCTGTTAATGAAGTTAAAGCCAC
AACGCCGGTAGATAATGTTAATTTTGACAGGGAATTTATTAACCAGCTGTACAGCAACAGAACAGACTAT
GTAAATAGCCTTTCTAAGCTAAATGAAAAAACTAAATCTGGATTAGTGAATCGATATCTTGATGAAAAAA
ACAGTGCGTTTAAAATGTTAACGGACCGGATATAA