SecReT6
Protein ID: 188532788
SecReT6 ID285
T6SS typei3
Gene symbol-
Locus tagETA_06410
StrainErwinia tasmaniensis Et1/99
Repliconchromosome [GenBank: NC_010694] [Browse all T6SS(s) in this replicon]
Location [Strand]704799..706940 [+]
ProductRhs element Vgr protein subfamily
NoteTssI
UniProt IDB2VH62
KEGG IDeta:ETA_06410
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-70, Aligned region: 22..327
Phage_base_V [PF04717], Evalue: 1.50E-25, Aligned region: 366..459
Gp5_C [PF06715], Evalue: 2.80E-16, Aligned region: 502..524
Gp5_C [PF06715], Evalue: 2.80E-16, Aligned region: 518..540
Gp5_C [PF06715], Evalue: 2.80E-16, Aligned region: 542..563
Gp5_C [PF06715], Evalue: 2.80E-16, Aligned region: 557..580
Gp5_C [PF06715], Evalue: 2.80E-16, Aligned region: 582..603
DUF2345 [PF10106], Evalue: 0.0032, Aligned region: 560..691
Protein Sequence: 713 a.a.     [Download]
>gi|188532788|ref|YP_001906585.1| Rhs element Vgr protein subfamily [Erwinia tasmaniensis Et1/99]
MFDRITVQLPMDGLLFWRLSGREALSHSFELSVQLLSTDARIERKALLGQPIVISIPTQGIMSTRYLNGK
ITKVSVSSLELGGTRYAVYTLMMEPDLWPLKRDKNLRIFQGQTVPQIVKTLLGEYNVRLEDRLTGSYRSW
EYCVQYQESSFNFISRLMELEGIYYYFRHEADGHTLVLMDAAAQHQPFSGYEAIPYHVTPSGGSTSAEGI
GLWSLEDSVTPGMYSIDDYDFRKPNAWMLQARQNPASPQPGAIDVYDWPGHFVDHEHGEFYTRIRQEVWQ
VEHQQIGAAGTALGLAPGHTFTVLNAPFISDNGEYLTTEAYYDFEENQYASGDGAGGTKHNIAIRVIPSA
VTFRAQPDTPWPRTHGPQTAKVVGPEGESIWTDKYGRIKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGYG
GVQIPRVGDEVVVDFINGDPDRPIITGRVYNEASMPPWALPAAATQMGFMSRSKDGTPDNANALRFEDKA
GAEQVWIHAERNMDTEIENDETRLVGSNRSKTIGGNETTQVKKDRTETVDQNETITIHQNRTETVDGNET
ITVHSNRTETVDKNEKVRIGQNQSVSINGNQSLQVDRAKTETIVLASMLNVGLAQNTNIGAAYLLNVGAG
WVTTTGAMQIHNVGMKYSVNSGKDINLSAGTTADYSAEDKISLVCGEAAIVLEKDGTITLSGSKIKLVGE
KMIDLDGTQIDIN
 
Nucleotide Sequence: 2142 bp     [Download]
>gi|188532165|ref|NC_010694.1|:704799-706940 Erwinia tasmaniensis Et1/99 chromosome, complete genome
ATGTTTGACCGTATCACCGTCCAGCTGCCGATGGACGGGCTGCTGTTCTGGCGTCTTAGCGGGCGCGAAG
CGCTGTCGCACTCATTTGAGCTGAGCGTACAGCTGTTAAGCACCGACGCGCGCATCGAGCGCAAGGCGCT
GCTCGGCCAGCCGATCGTCATCTCCATCCCCACCCAGGGGATAATGAGCACCCGCTACCTGAACGGTAAA
ATCACCAAAGTCTCGGTCAGCAGCCTGGAGCTGGGCGGCACGCGCTATGCGGTGTATACCCTGATGATGG
AGCCGGACCTGTGGCCGCTGAAACGGGATAAAAACCTGCGTATTTTCCAGGGGCAGACGGTGCCGCAGAT
CGTCAAAACCCTGCTCGGCGAGTACAACGTCAGGCTGGAAGACCGCCTGACCGGCAGCTACCGCAGCTGG
GAGTACTGCGTGCAGTACCAGGAGAGCAGCTTTAACTTTATCAGCCGGCTGATGGAGCTGGAGGGGATCT
ATTACTACTTCCGCCACGAGGCGGACGGGCACACGCTGGTGCTGATGGACGCGGCGGCGCAGCATCAGCC
GTTCAGCGGCTACGAGGCGATCCCTTACCACGTCACGCCGTCCGGCGGCAGCACCAGCGCAGAGGGCATC
GGGTTGTGGTCGCTGGAGGACAGCGTCACGCCGGGGATGTACAGCATCGACGACTACGACTTCCGCAAGC
CGAACGCGTGGATGCTCCAGGCGCGGCAGAATCCGGCCTCGCCGCAGCCGGGGGCCATCGACGTCTACGA
CTGGCCGGGCCACTTTGTCGACCACGAGCACGGCGAGTTCTACACGCGCATCCGCCAGGAGGTGTGGCAG
GTGGAGCACCAGCAGATCGGTGCCGCCGGTACCGCGCTGGGGCTGGCGCCGGGCCATACCTTTACGGTGC
TGAACGCGCCGTTTATCAGCGATAACGGCGAGTACCTGACTACCGAGGCGTACTACGATTTTGAAGAGAA
TCAGTACGCCAGCGGCGACGGTGCCGGCGGAACAAAACACAATATCGCCATCCGCGTGATCCCCTCCGCC
GTAACGTTCCGCGCACAGCCGGACACGCCGTGGCCGCGCACCCACGGGCCGCAGACGGCGAAGGTGGTGG
GGCCGGAGGGCGAGTCGATCTGGACCGATAAATATGGCCGCATCAAGGTGAAGTTTCACTGGGATCGGCT
GGCGAAGGGCGACGACACCAGCTCGTGCTGGGTGCGCGTTTCCAGCGCCTGGGCGGGTCAGGGCTACGGC
GGTGTGCAGATCCCGCGCGTGGGCGACGAGGTGGTCGTCGACTTTATCAACGGCGATCCGGACCGGCCAA
TCATCACCGGGCGCGTGTACAACGAGGCGAGCATGCCGCCGTGGGCGCTGCCGGCCGCCGCGACGCAGAT
GGGCTTTATGAGCCGCTCGAAGGACGGCACGCCGGACAACGCTAACGCGCTGCGCTTCGAGGATAAGGCG
GGCGCGGAGCAGGTGTGGATCCATGCTGAGCGCAATATGGACACCGAAATTGAGAACGACGAAACGCGAC
TGGTTGGTAGCAACCGCAGTAAAACTATTGGTGGTAATGAAACCACACAGGTGAAGAAAGATCGCACCGA
AACGGTTGACCAGAATGAAACGATCACTATCCACCAGAACCGTACTGAAACCGTAGACGGCAATGAAACC
ATCACCGTGCACAGTAACCGGACTGAAACGGTGGATAAGAATGAAAAAGTGCGCATCGGGCAGAATCAAT
CGGTCAGTATTAATGGTAATCAATCATTGCAGGTAGATCGGGCAAAAACAGAAACTATCGTGCTGGCTTC
AATGCTGAACGTGGGCCTGGCGCAAAATACCAATATTGGCGCGGCTTATCTCCTCAACGTTGGCGCTGGC
TGGGTGACCACCACTGGCGCAATGCAAATACATAACGTGGGGATGAAATATTCGGTTAACAGCGGCAAGG
ATATCAACCTTTCAGCTGGGACGACCGCCGACTACAGTGCGGAAGATAAAATCTCGCTGGTATGCGGCGA
GGCGGCAATTGTACTGGAAAAGGATGGCACCATCACGCTTAGCGGCAGCAAAATCAAGCTGGTTGGTGAG
AAGATGATTGATCTGGACGGCACACAGATAGATATCAACTGA