SecReT6
Protein ID: 188575804
SecReT6 ID286
T6SS typei3
Gene symbol-
Locus tagPXO_00270
StrainXanthomonas oryzae pv. oryzae PXO99A
Repliconchromosome [GenBank: NC_010717] [Browse all T6SS(s) in this replicon]
Location [Strand]1586899..1589661 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDB2STF6
KEGG IDxop:PXO_00270
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.10E-71, Aligned region: 41..355
Phage_GPD [PF05954], Evalue: 1.10E-71, Aligned region: 809..839
DUF2345 [PF10106], Evalue: 8.20E-38, Aligned region: 723..886
T6SS_Vgr [PF13296], Evalue: 8.10E-27, Aligned region: 200..237
T6SS_Vgr [PF13296], Evalue: 8.10E-27, Aligned region: 293..323
T6SS_Vgr [PF13296], Evalue: 8.10E-27, Aligned region: 579..683
Phage_base_V [PF04717], Evalue: 2.10E-19, Aligned region: 225..250
Phage_base_V [PF04717], Evalue: 2.10E-19, Aligned region: 434..537
Protein Sequence: 920 a.a.     [Download]
>gi|188575804|ref|YP_001912733.1| unnamed protein product [Xanthomonas oryzae pv. oryzae PXO99A]
MDPVATVLSALSAAPRQQERLLRLHTPLGPDVLVAETLDGRESVDGGGFRFDVGALSANAGLPLDDLLGQ
PVLLELLTAESRTALRPFHGHVTAFERLGSNGGLARYRLVVEPWLALLAQRVDSYVFQDMSVVEIAESVF
ADYAGQGALAPAWRWELSDRSTYARRSLTTQYEETDFAFLSRLLAEEGIAYWFEHTGAADSATRGTHTLV
LSDHNAAFADLGTVRYHRTDVTEQQDSVQQWVQAHRWRATSLSRASWDYRNRSLRLAGAEGTPLGDIGAE
DVDTAGPYGWQDSTRGQRRAQQHLDAQQVTAQTIQGQGTWRQLAPGTRFGLRQHAVVAADAQFLCLQVRH
QARNNLGAEVFDALEQALGAVAVAGAPLPPALAGLSGGYVPAQDEAAVEFYRNQFTAIPATATYRPQTED
GHGVRLHPKPTVVGTLSAIVVSDGDPVQSDRDHRIKVQFPFQRGADASSALAHPGGEDNAPGSASAWTWV
RVMTPWAGDNWGGVVLPRKGQEVLVGFLEGDIDRPVVIGSVYNGRGQDDAAHNQVGGGGAGATGNAPAWF
QGNAHGAVFTGFKSQALAQSQDGTGGYQQLRLDDTPGQGRAQLSTTQHASTLTLGHLKGGHDNLREGERG
YGADLSTQAYGAVRAGQGLLLSSEPGNTQLAATGALSQLQQGSDLLKRLNDAARTQQAGLPSEPESLPTQ
DGLKTLQDHLQATHSGSAAGAIGGGTGEVPGWSAPVLLGSGQAGVMSLTPADQVWVSGTQTALLAGSALN
WLSQGHLVLAVAGGLVLYTQGSDPVAGSPNQERGIALHAAQGTLSARAHRSTATLAAKTQVRIVSTTADV
QLAAPTKHLLATAAGAYIKLDGDDIELGAPGVVAFKGGQQVLTGPQGSTASVSIPQAQFKGCDPTLVNAQ
LRSEAAADLG
 
Nucleotide Sequence: 2763 bp     [Download]
>gi|188574270|ref|NC_010717.1|:c1589661-1586899 Xanthomonas oryzae pv. oryzae PXO99A chromosome, complete genome
ATGGACCCGGTCGCCACAGTACTTTCCGCCCTCAGCGCCGCCCCGCGGCAGCAAGAACGCCTGCTGCGGT
TGCATACCCCGCTTGGCCCCGACGTGCTGGTCGCCGAGACGCTCGACGGCCGCGAGTCGGTCGATGGCGG
CGGCTTCCGTTTCGACGTGGGCGCACTATCGGCCAACGCCGGCTTGCCGCTGGACGACCTGCTCGGCCAG
CCGGTGCTGCTGGAACTGCTCACCGCCGAGTCGCGCACCGCGCTGCGCCCGTTCCACGGCCATGTCACCG
CGTTCGAACGCCTCGGCAGCAACGGCGGCCTGGCGCGCTACCGGCTGGTGGTGGAGCCGTGGCTGGCGCT
GCTGGCCCAGCGCGTGGACAGCTACGTGTTCCAGGACATGAGCGTGGTGGAGATCGCCGAGAGCGTGTTC
GCCGACTACGCCGGGCAAGGCGCGCTGGCGCCGGCGTGGCGCTGGGAGCTGTCCGACCGCAGCACGTACG
CCAGGCGCAGCCTGACCACGCAATACGAAGAGACCGACTTCGCGTTCCTGAGCCGGCTGCTGGCCGAGGA
AGGCATCGCCTATTGGTTCGAGCACACCGGCGCAGCCGACAGCGCCACGCGCGGCACGCACACGCTGGTG
CTGTCGGACCATAACGCCGCCTTCGCCGACCTGGGCACGGTGCGCTACCACCGCACCGACGTCACCGAGC
AGCAGGACAGCGTGCAGCAGTGGGTACAGGCACATCGCTGGCGCGCGACCAGTCTGTCGCGGGCCAGCTG
GGACTACCGCAACCGCAGCCTGCGCCTGGCCGGTGCCGAAGGCACGCCGCTGGGCGACATCGGTGCCGAG
GACGTGGACACCGCCGGCCCGTACGGCTGGCAGGACAGCACCCGTGGCCAGCGCCGCGCGCAGCAGCATC
TGGATGCGCAGCAGGTGACGGCGCAGACCATCCAGGGCCAGGGGACCTGGCGGCAACTGGCACCGGGCAC
GCGTTTCGGGCTGCGCCAGCATGCGGTCGTGGCGGCCGATGCGCAGTTCCTGTGCCTGCAGGTGCGGCAC
CAGGCGCGCAACAATCTGGGCGCGGAGGTGTTCGACGCGCTGGAGCAGGCGCTGGGCGCGGTGGCGGTGG
CCGGCGCGCCGCTGCCGCCGGCGCTGGCAGGCCTGAGCGGCGGATATGTGCCGGCGCAGGATGAGGCGGC
GGTAGAGTTCTACCGCAACCAGTTCACCGCCATACCGGCCACCGCGACCTACCGGCCGCAAACCGAGGAC
GGCCACGGCGTGCGCCTGCATCCCAAGCCAACGGTCGTCGGCACGCTGAGCGCGATCGTGGTCAGCGACG
GCGACCCGGTGCAGTCCGACCGCGACCACCGGATCAAGGTGCAGTTCCCGTTCCAGCGCGGGGCCGACGC
CAGCAGCGCGCTGGCGCATCCCGGGGGCGAGGACAACGCGCCGGGCAGCGCCTCGGCGTGGACCTGGGTG
CGGGTGATGACGCCGTGGGCCGGGGACAACTGGGGCGGCGTGGTGCTGCCGCGCAAGGGCCAGGAAGTGC
TGGTGGGGTTCCTGGAAGGGGACATCGACCGGCCGGTGGTGATCGGCAGCGTGTACAACGGGCGCGGCCA
GGACGACGCGGCGCACAACCAGGTCGGCGGCGGCGGGGCCGGAGCCACCGGCAATGCGCCGGCGTGGTTC
CAGGGCAACGCGCACGGCGCGGTGTTCACCGGGTTCAAGAGCCAGGCGCTGGCGCAGAGCCAGGACGGCA
CCGGCGGCTACCAGCAGCTGCGGCTGGACGACACGCCCGGCCAGGGCCGCGCGCAGCTGTCGACCACCCA
GCACGCCAGCACCTTGACCCTGGGCCACCTGAAGGGCGGCCACGACAACCTGCGCGAAGGCGAGCGCGGG
TACGGGGCGGACCTGTCCACGCAGGCCTACGGCGCGGTGCGCGCCGGCCAGGGCCTGCTGCTGAGCAGCG
AGCCGGGCAACACCCAACTGGCCGCCACCGGCGCGCTGAGCCAACTGCAGCAGGGCAGCGACCTGCTCAA
GCGCCTCAACGACGCCGCCCGCACCCAGCAGGCGGGCCTACCGAGCGAACCGGAGTCCCTGCCGACCCAG
GACGGCCTGAAGACCTTGCAGGACCACCTGCAGGCCACCCACAGCGGCAGCGCGGCCGGCGCGATCGGCG
GTGGCACCGGCGAGGTGCCCGGCTGGAGCGCCCCAGTGCTGCTGGGCAGCGGCCAGGCCGGCGTGATGAG
CCTGACCCCGGCCGACCAGGTGTGGGTGTCGGGCACCCAGACCGCGCTGCTGGCCGGCAGCGCACTGAAC
TGGCTCAGCCAGGGCCACCTGGTGCTGGCGGTGGCCGGCGGGCTGGTGCTGTACACCCAGGGCAGCGACC
CGGTCGCCGGCAGCCCCAACCAGGAGCGCGGCATCGCCCTGCACGCCGCGCAAGGCACGCTCAGCGCTCG
CGCGCACAGGAGCACCGCCACCCTGGCCGCCAAGACCCAGGTGCGCATCGTCAGCACCACCGCCGACGTC
CAGCTCGCCGCGCCGACCAAGCACCTGCTGGCCACCGCGGCCGGCGCCTACATCAAGCTGGACGGCGACG
ATATCGAACTGGGCGCGCCGGGGGTGGTCGCGTTCAAGGGCGGGCAGCAGGTGTTGACCGGGCCGCAGGG
CAGCACCGCGTCGGTGTCCATCCCGCAGGCGCAGTTCAAGGGCTGCGATCCGACATTGGTCAATGCGCAG
CTTCGCTCCGAAGCCGCCGCAGACCTAGGGTGA