SecReT6
Protein ID: 188575808
SecReT6 ID286
T6SS typei3
Gene symbol-
Locus tagPXO_00266
StrainXanthomonas oryzae pv. oryzae PXO99A
Repliconchromosome [GenBank: NC_010717] [Browse all T6SS(s) in this replicon]
Location [Strand]1592594..1593046 [+]
Producthypothetical protein
NoteTssB
UniProt IDB2STG0
KEGG IDxop:PXO_00266
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.70E-50, Aligned region: 2..146
Protein Sequence: 150 a.a.     [Download]
>gi|188575808|ref|YP_001912737.1| unnamed protein product [Xanthomonas oryzae pv. oryzae PXO99A]
MQIEYDVEIYGSQKKVQVPFVMGVLSDLSGANTEHLPALEAREAVEMDVDNFDSRLRAMQPRVAMSVSNT
LTGSGELPVDITFDSLDDFSPTAVVKKVAPLAELLEARTQLANLGTYLDGKAGAERLIADAIKDPTLLRS
LVAAPKSKDA
 
Nucleotide Sequence: 453 bp     [Download]
>gi|188574270|ref|NC_010717.1|:1592594-1593046 Xanthomonas oryzae pv. oryzae PXO99A chromosome, complete genome
GTGCAGATCGAGTACGACGTCGAGATTTACGGCTCGCAGAAAAAGGTGCAGGTTCCGTTCGTCATGGGTG
TGTTGTCGGATCTGTCCGGCGCCAATACCGAACACCTGCCGGCGCTGGAAGCACGCGAGGCAGTGGAAAT
GGATGTCGACAATTTCGACAGCCGGCTGCGTGCCATGCAACCGCGCGTGGCCATGAGCGTTTCCAATACG
CTCACCGGCAGCGGCGAGTTACCGGTCGATATCACCTTCGACAGCCTGGACGATTTTTCGCCCACCGCGG
TCGTGAAAAAGGTGGCACCGCTGGCCGAGCTGCTGGAAGCACGTACCCAGCTGGCCAATCTAGGCACTTA
CCTTGACGGCAAAGCCGGCGCCGAGCGCTTGATCGCCGATGCGATCAAGGATCCCACCCTGCTGCGTTCG
CTGGTCGCGGCTCCCAAGTCGAAGGATGCGTAA