SecReT6
Protein ID: 188575809
SecReT6 ID286
T6SS typei3
Gene symbolsciI
Locus tagPXO_00265
StrainXanthomonas oryzae pv. oryzae PXO99A
Repliconchromosome [GenBank: NC_010717] [Browse all T6SS(s) in this replicon]
Location [Strand]1593051..1594553 [+]
ProductSciI protein
NoteTssC
UniProt IDB2STG1
KEGG IDxop:PXO_00265
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-192, Aligned region: 69..495
Protein Sequence: 500 a.a.     [Download]
>gi|188575809|ref|YP_001912738.1| sciI gene product [Xanthomonas oryzae pv. oryzae PXO99A]
MVTQHSAAQDLAEAQPQTSQTDDFAALLTREFRPRSERAGEEVRLAVRTLAEQVLERSDIISDDLAQTIN
AYVAEIDRKISEQLNLILHAPQFQALEGAWRGLHYLVSNTESDTQLKIRVLNVSKRELAKNLKRFKGTAW
DQSPVFKKIYEAEYGQLGGEPYGCLIGDYHFDHSPQDVDTLRGISQIAAASHAPFIAAAGPGLMGMESWS
ELSNPRDLAKIFSTPDYAAWRSLRQSEDAKYLALAMPRTLARLPYGVKTDPVEAFDFEEDTQGADSSCYT
WQNAAYAMAVNINRSFKQYGWCTRIRGVESGGAVEGLPTHTFPADDGGVDMKCPTEVAITDRRSAELDKM
GLMPLVHRKNTDMAAFISAQSLGKPEEYDDPDATANAALSARLPYMFACCRFAHYLKCIVRDKIGSFSTR
QQMQSWLTDWVMNYVDGDPANSSEETKARKPLAAAEVVVEEVEGNPGYYTSKFFLRPHYQLEGLTVSLRL
VSRLPSAQAA
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|188574270|ref|NC_010717.1|:1593051-1594553 Xanthomonas oryzae pv. oryzae PXO99A chromosome, complete genome
ATGGTGACCCAACATTCCGCTGCCCAAGACCTTGCCGAAGCGCAGCCGCAAACCAGTCAGACCGACGACT
TTGCGGCCCTGCTGACCCGCGAATTCCGTCCGCGTAGCGAACGCGCCGGCGAAGAAGTGCGGTTGGCTGT
GCGCACCTTGGCCGAACAGGTGCTGGAACGCAGCGACATCATCAGCGACGACCTCGCGCAGACAATCAAC
GCGTATGTCGCCGAGATCGACCGCAAGATCAGCGAGCAACTCAACCTCATCCTGCACGCCCCGCAATTCC
AGGCGCTGGAGGGTGCATGGCGCGGACTGCATTATCTGGTCAGCAACACCGAATCGGACACGCAGTTGAA
GATCCGCGTGCTCAACGTGTCCAAAAGGGAGCTCGCCAAGAACCTCAAGCGCTTCAAGGGCACCGCCTGG
GACCAGAGCCCGGTATTCAAGAAAATTTACGAAGCCGAGTACGGCCAGCTGGGTGGCGAACCCTACGGCT
GTTTGATTGGCGATTACCACTTCGACCATAGCCCGCAGGATGTCGACACGCTGCGCGGCATCAGCCAGAT
TGCCGCCGCCTCGCATGCGCCTTTCATCGCCGCTGCGGGTCCTGGCCTGATGGGGATGGAAAGCTGGAGC
GAGCTGTCCAACCCGCGCGATCTGGCCAAGATTTTTTCCACCCCCGATTACGCGGCTTGGCGTTCGTTGC
GTCAGAGCGAGGATGCCAAGTACCTGGCGCTTGCCATGCCGCGCACGCTGGCGCGGCTGCCGTACGGAGT
CAAGACCGATCCGGTGGAAGCGTTCGACTTCGAAGAAGACACCCAGGGCGCCGATTCGTCGTGCTACACC
TGGCAAAACGCCGCCTACGCGATGGCGGTCAACATCAACCGCTCCTTCAAGCAGTACGGTTGGTGCACCC
GCATTCGCGGCGTGGAGTCGGGTGGGGCGGTGGAAGGCCTGCCGACGCATACCTTCCCGGCCGACGATGG
CGGTGTGGACATGAAGTGCCCGACCGAGGTCGCGATTACCGACCGCCGTTCGGCCGAACTCGACAAGATG
GGTCTGATGCCGCTGGTACATCGCAAGAACACCGATATGGCAGCCTTCATCAGCGCGCAGTCGCTGGGCA
AGCCCGAGGAATACGACGACCCGGATGCCACCGCCAACGCGGCGCTGAGCGCACGCCTGCCGTATATGTT
CGCTTGCTGCCGCTTCGCGCACTATTTGAAGTGCATCGTGCGCGACAAGATCGGCTCGTTCAGCACGCGC
CAGCAGATGCAGAGCTGGTTGACCGATTGGGTGATGAACTACGTCGACGGCGACCCGGCCAATTCCAGCG
AAGAAACCAAGGCGCGTAAGCCATTGGCTGCTGCCGAAGTGGTCGTCGAAGAGGTCGAGGGCAACCCCGG
CTACTACACCTCCAAGTTCTTCCTGCGCCCGCATTACCAGCTCGAAGGCCTGACGGTATCGCTACGCCTG
GTCTCGCGCTTGCCATCGGCGCAGGCAGCCTGA