SecReT6
Protein ID: 188575810
SecReT6 ID286
T6SS typei3
Gene symbol-
Locus tagPXO_00264
StrainXanthomonas oryzae pv. oryzae PXO99A
Repliconchromosome [GenBank: NC_010717] [Browse all T6SS(s) in this replicon]
Location [Strand]1594653..1595156 [+]
Producthypothetical protein
NoteTssD
UniProt IDB2STG2
KEGG IDxop:PXO_00264
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.00E-36, Aligned region: 7..141
Protein Sequence: 167 a.a.     [Download]
>gi|188575810|ref|YP_001912739.1| unnamed protein product [Xanthomonas oryzae pv. oryzae PXO99A]
MAFDMHLKFGSGDVEIKGASNHTKHKDQVPIIAWSWGTSNTGNLHTGAGYAAGGKANVKDISITKYVDSC
SNALLNACCTGARVDSATLYVTNATGEQSDYVTIELSEGVMITSVSTGGSGGEDRLTENVTLHFGKFKYS
FQPQDDKGKKQGGTKDFTFNMQEVKKS
 
Nucleotide Sequence: 504 bp     [Download]
>gi|188574270|ref|NC_010717.1|:1594653-1595156 Xanthomonas oryzae pv. oryzae PXO99A chromosome, complete genome
ATGGCTTTCGATATGCATCTCAAATTCGGCTCGGGCGACGTCGAGATCAAGGGCGCGTCCAACCATACCA
AGCACAAGGACCAAGTGCCGATCATTGCCTGGTCGTGGGGCACCAGCAACACCGGCAACCTGCATACCGG
CGCCGGGTATGCAGCCGGCGGCAAGGCCAATGTGAAGGATATTTCCATCACCAAGTACGTCGATAGTTGC
TCCAATGCCTTGCTCAACGCCTGCTGCACGGGTGCGCGTGTGGATTCGGCCACGCTGTACGTCACCAACG
CCACCGGCGAGCAGTCGGACTACGTGACGATCGAACTCAGCGAAGGCGTGATGATCACCTCGGTGTCCAC
CGGCGGTAGCGGTGGCGAGGACCGTCTGACCGAAAACGTGACCCTGCATTTCGGCAAGTTCAAGTATTCG
TTCCAGCCGCAGGACGACAAGGGCAAGAAGCAGGGCGGCACCAAGGACTTCACGTTCAACATGCAGGAAG
TGAAGAAGTCCTGA