SecReT6
Protein ID: 188575811
SecReT6 ID286
T6SS typei3
Gene symbolimpE
Locus tagPXO_00263
StrainXanthomonas oryzae pv. oryzae PXO99A
Repliconchromosome [GenBank: NC_010717] [Browse all T6SS(s) in this replicon]
Location [Strand]1595192..1596025 [+]
ProductImpE protein
NoteTagJ
UniProt IDB2STG3
KEGG IDxop:PXO_00263
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 2.10E-39, Aligned region: 144..266
TPR_19 [PF14559], Evalue: 0.00084, Aligned region: 13..68
TPR_19 [PF14559], Evalue: 0.00084, Aligned region: 113..132
TPR_14 [PF13428], Evalue: 0.0036, Aligned region: 13..46
TPR_14 [PF13428], Evalue: 0.0036, Aligned region: 43..68
TPR_14 [PF13428], Evalue: 0.0036, Aligned region: 113..134
TPR_16 [PF13432], Evalue: 0.0095, Aligned region: 12..67
TPR_16 [PF13432], Evalue: 0.0095, Aligned region: 113..137
Protein Sequence: 277 a.a.     [Download]
>gi|188575811|ref|YP_001912740.1| impE gene product [Xanthomonas oryzae pv. oryzae PXO99A]
MSAVHPEHACARLLKAGDPAQSLATAKDWVRQCPADAQARIGLFQLLAVAGEWQRAQQQLRLAAELDQGW
GGVVAAYVRILDAELEREQVLAGRMMPLMPGQVPPWQQDLLQALQHDRDGEPGQAARRRALALTQADAIA
GHIDGRRFDWLADADPRFGPCLEVILEVGYAWVPFVQLRSLCLEAPTTLRDLLWQSVDIQWHDGTRSRGV
VPCRYPGSQHSEQGAIRLGQRTEWKGEALSACGLGQRLLAGSEDDYPVLDIRHIAFDTAAVEAPWPN
 
Nucleotide Sequence: 834 bp     [Download]
>gi|188574270|ref|NC_010717.1|:1595192-1596025 Xanthomonas oryzae pv. oryzae PXO99A chromosome, complete genome
ATGTCTGCTGTCCATCCCGAACATGCCTGCGCCCGCCTGCTCAAGGCGGGCGACCCGGCGCAATCGTTGG
CCACCGCCAAGGACTGGGTGCGGCAGTGCCCGGCCGATGCCCAAGCGCGCATCGGGCTGTTCCAACTGTT
GGCGGTGGCCGGAGAGTGGCAGCGCGCGCAACAACAATTGCGCCTGGCCGCGGAGTTGGACCAGGGTTGG
GGCGGGGTCGTGGCTGCGTATGTGCGCATCCTCGACGCTGAACTGGAACGCGAACAGGTGCTGGCCGGCC
GAATGATGCCGCTGATGCCTGGTCAGGTCCCGCCGTGGCAGCAGGATCTGCTGCAGGCATTGCAGCATGA
TCGCGACGGCGAACCAGGGCAGGCAGCGCGACGGCGTGCCCTGGCGCTTACGCAAGCCGATGCCATCGCT
GGCCATATCGATGGCCGGCGTTTCGACTGGCTGGCCGACGCCGACCCGCGTTTTGGTCCGTGCCTTGAGG
TCATCCTCGAAGTGGGCTACGCGTGGGTGCCGTTCGTCCAATTGCGCAGCCTGTGCTTGGAAGCCCCGAC
CACGCTGCGCGACTTGCTATGGCAGTCGGTCGACATCCAATGGCATGACGGCACACGCAGCCGTGGCGTG
GTGCCGTGCCGTTACCCCGGTAGCCAACACAGCGAGCAGGGCGCGATCCGCCTTGGCCAGCGCACCGAAT
GGAAGGGCGAGGCGTTGTCCGCATGCGGTCTGGGGCAACGCTTGCTGGCTGGCAGCGAGGACGACTACCC
GGTGCTCGACATCCGCCACATCGCATTCGACACCGCCGCGGTGGAAGCGCCATGGCCGAACTGA