SecReT6
Protein ID: 188575812
SecReT6 ID286
T6SS typei3
Gene symbol-
Locus tagPXO_00262
StrainXanthomonas oryzae pv. oryzae PXO99A
Repliconchromosome [GenBank: NC_010717] [Browse all T6SS(s) in this replicon]
Location [Strand]1596013..1596516 [+]
Producthypothetical protein
NoteTssE
UniProt IDB2STG4
KEGG IDxop:PXO_00262
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.90E-20, Aligned region: 36..144
Protein Sequence: 167 a.a.     [Download]
>gi|188575812|ref|YP_001912741.1| unnamed protein product [Xanthomonas oryzae pv. oryzae PXO99A]
MAELTQQERLQPSLLDRLIDDRRHEPAESRDARAISPAKLRDCVMRDLAWLLNCTRHWHEDALQAYPHVA
SSVLNYGIPDLAGARLAGLDVIALQNRIREAIVAFEPRLAAASLQVTAKVDIGRMDRMSLSFVIDSELWA
QPLPLALYLRTDLDLETGRFSLSSAGH
 
Nucleotide Sequence: 504 bp     [Download]
>gi|188574270|ref|NC_010717.1|:1596013-1596516 Xanthomonas oryzae pv. oryzae PXO99A chromosome, complete genome
ATGGCCGAACTGACCCAACAAGAGCGTTTGCAGCCATCGCTGCTGGACCGATTGATCGACGACCGCCGAC
ACGAACCGGCGGAAAGCCGCGACGCGCGGGCGATCAGTCCAGCCAAGCTGCGCGACTGCGTCATGCGCGA
CCTGGCCTGGCTGCTCAATTGCACGCGCCACTGGCATGAGGATGCGTTGCAGGCGTATCCGCACGTCGCC
AGCTCGGTACTCAATTACGGCATTCCCGACCTGGCCGGCGCACGGCTGGCGGGGCTGGACGTGATCGCAC
TGCAGAACCGCATTCGTGAGGCGATTGTGGCGTTCGAGCCGCGCCTGGCTGCGGCCAGCCTGCAGGTCAC
CGCGAAAGTGGATATCGGGCGCATGGACCGCATGTCGCTGTCCTTCGTCATCGATTCCGAATTGTGGGCA
CAGCCGCTGCCGCTGGCGCTGTATCTGCGCACCGATCTCGATCTGGAAACCGGTCGTTTCAGTCTGTCTT
CGGCAGGCCACTGA