SecReT6
Protein ID: 188575813
SecReT6 ID286
T6SS typei3
Gene symbolsciC
Locus tagPXO_00261
StrainXanthomonas oryzae pv. oryzae PXO99A
Repliconchromosome [GenBank: NC_010717] [Browse all T6SS(s) in this replicon]
Location [Strand]1596520..1598397 [+]
ProductSciC protein
NoteTssF
UniProt IDB2STG5
KEGG IDxop:PXO_00261
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.90E-214, Aligned region: 5..625
Protein Sequence: 625 a.a.     [Download]
>gi|188575813|ref|YP_001912742.1| sciC gene product [Xanthomonas oryzae pv. oryzae PXO99A]
MDPRLLHHYNRELQHVREMGAEFAQAYPKVAGRLGMSGIECADPYVERLLEGFAFLSARVQVELEAQQPA
FAQHLTEMLYPHFLSPVPSMAVVELQPEQGEGIGPAGHVVPRGSALRSLIGHGDRTACEYRTAHAVTLLP
LRLTAASYLTSPAALATLGVPVEPRARAGLRLVFNVDPGLRLDMLALDTLPIFITGADGLAGTLHEQLHA
NALGFVVRTRSADGQVLTRTFGPEHLQPQGFDDEQALLPRSERSFSGYRLLQEYFACPERFLFTAFDGLA
QVLTRAACAEFEMLVWFDRSVERLDNAVDASNFRLHCTPAINLFPRRGDRIHLHPGISEHHVLADRTRPM
DFEIHGVEQVEGFGDGNAPMQRFEPFYGAQPRSWHERRSAFYALRRQPRRLSTGQRRTGPRSSYVGSEVF
LSLVDGDQAPYSHQLRQLGMQLWCSNRDLPLHMPVGKSSTDFVLDDGGPVASIRCVAGPTRPRSGVTAGD
TRWRLISHLQLNYLSLLDAGDDGATALREMLTLYHDPHDAAARRQVDGVRRIASRPIVRRIPVPGPATYG
RGLEITLTCDDAAFEGQGVYLLASVLRHVFARQASLNSFTETVLCTPERNEVARWPAHLGNRPIL
 
Nucleotide Sequence: 1878 bp     [Download]
>gi|188574270|ref|NC_010717.1|:1596520-1598397 Xanthomonas oryzae pv. oryzae PXO99A chromosome, complete genome
ATGGATCCGCGCCTGCTCCATCACTACAACCGCGAGTTGCAGCATGTGCGCGAGATGGGTGCGGAATTCG
CGCAGGCGTATCCGAAAGTGGCGGGCCGGCTTGGGATGAGCGGTATCGAGTGCGCCGACCCGTATGTCGA
ACGTCTGCTGGAAGGGTTTGCCTTCCTGTCTGCGCGCGTGCAGGTCGAACTCGAAGCCCAGCAGCCTGCA
TTCGCGCAGCATCTGACGGAAATGCTGTATCCACATTTCCTGTCGCCGGTGCCGTCGATGGCCGTGGTGG
AGCTGCAACCGGAGCAAGGCGAGGGCATCGGCCCAGCGGGGCATGTGGTGCCGCGCGGCAGCGCGTTGCG
CTCGTTGATCGGGCATGGCGACCGCACCGCCTGCGAATATCGCACCGCGCACGCGGTGACGCTGTTGCCG
CTGCGCCTGACTGCCGCCAGTTATCTCACCTCGCCGGCAGCGCTGGCCACGCTCGGTGTGCCGGTCGAGC
CGCGTGCGCGCGCCGGCCTTCGCCTGGTCTTCAACGTCGACCCCGGGCTGCGCCTGGACATGCTGGCGCT
GGACACATTGCCGATCTTCATCACCGGCGCCGATGGGTTGGCCGGCACCCTCCACGAACAACTGCATGCC
AATGCGTTGGGATTTGTGGTGCGTACCCGCTCCGCGGATGGGCAGGTGCTGACGCGCACCTTCGGTCCCG
AGCATCTGCAGCCGCAGGGCTTCGATGACGAGCAGGCGCTGCTGCCGCGCAGCGAACGCTCTTTCAGCGG
CTATCGCCTGCTGCAGGAATATTTTGCCTGCCCCGAGCGTTTCCTGTTTACCGCCTTCGATGGCCTGGCG
CAGGTGCTGACGCGAGCGGCGTGCGCCGAATTCGAGATGTTGGTGTGGTTCGACCGCAGCGTCGAGCGGC
TCGATAACGCGGTGGACGCAAGTAACTTCCGCCTGCATTGCACCCCGGCGATCAACCTGTTTCCTCGGCG
CGGTGATCGTATCCATCTGCATCCCGGCATCTCCGAGCACCACGTGCTGGCCGACCGCACGCGGCCGATG
GACTTCGAGATTCATGGCGTGGAGCAGGTCGAAGGCTTCGGCGATGGCAATGCGCCAATGCAGCGTTTCG
AGCCGTTCTATGGCGCGCAGCCGCGCAGTTGGCATGAGCGGCGTTCGGCATTTTATGCCTTGCGACGGCA
GCCGCGGCGGCTGTCGACGGGACAGCGTCGTACCGGGCCGCGCTCGAGCTACGTTGGCAGCGAGGTGTTC
CTGTCGCTGGTCGATGGCGACCAGGCGCCGTATTCGCACCAACTGCGGCAACTGGGCATGCAGCTGTGGT
GCAGCAACCGCGATCTGCCGCTGCATATGCCGGTGGGCAAATCCAGCACCGACTTCGTCCTCGACGATGG
CGGCCCGGTGGCGTCGATCCGCTGCGTTGCAGGTCCAACGCGACCGCGCTCGGGCGTGACCGCCGGCGAT
ACCCGCTGGCGCCTGATCAGCCATCTGCAGTTGAACTATCTCTCGCTGCTGGATGCCGGCGACGACGGTG
CCACCGCATTGCGCGAGATGCTCACGCTGTACCACGACCCGCACGATGCCGCTGCGCGACGACAGGTAGA
CGGCGTGCGCCGCATCGCTTCGCGCCCGATCGTACGGCGCATTCCGGTGCCGGGCCCGGCCACCTATGGC
CGCGGGCTTGAGATCACCTTGACCTGCGACGACGCGGCCTTTGAAGGGCAGGGCGTCTATCTGCTTGCCT
CGGTGCTGCGGCATGTCTTTGCGCGCCAGGCATCGCTCAATTCCTTTACCGAAACCGTGCTATGCACGCC
CGAACGCAACGAGGTCGCTCGATGGCCAGCCCATCTCGGCAATCGGCCGATCCTGTAG