SecReT6
Protein ID: 188575814
SecReT6 ID286
T6SS typei3
Gene symbol-
Locus tagPXO_00260
StrainXanthomonas oryzae pv. oryzae PXO99A
Repliconchromosome [GenBank: NC_010717] [Browse all T6SS(s) in this replicon]
Location [Strand]1598361..1599371 [+]
Producthypothetical protein
NoteTssG
UniProt IDB2STG6
KEGG IDxop:PXO_00260
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 8.20E-110, Aligned region: 20..321
Protein Sequence: 336 a.a.     [Download]
>gi|188575814|ref|YP_001912743.1| unnamed protein product [Xanthomonas oryzae pv. oryzae PXO99A]
MASPSRQSADPVALFARLDAQPQAFELFEALRWLECAHPAQPRLGQAARPLEEPVRLGQRASLEFPPRDI
DSVHAGVDGRPPTLRTLSLGLFGPHGALPLHLTEHAIERESAGDPTFAAFADMFHHRMIALWYRAWADAR
PTVQMDRVGDDRFGARLDALTGVDQPALRDRDAMPVAARRHFAGRFIAQARNAEGLRAVLTGLFDVPVQV
QEFVANWLTLPEEGRLRMGRAAARIGRDATLGASARNAQHRFRLRIGPLEIARYREFLPGGQALDVLTAA
VRGYIGDEQAWDLQLVLAREDVPLPVLGQGQRIGLSLWLGHYRRPLDADQLVLTSP
 
Nucleotide Sequence: 1011 bp     [Download]
>gi|188574270|ref|NC_010717.1|:1598361-1599371 Xanthomonas oryzae pv. oryzae PXO99A chromosome, complete genome
ATGGCCAGCCCATCTCGGCAATCGGCCGATCCTGTAGCGCTGTTCGCGCGGCTGGATGCGCAACCGCAGG
CCTTCGAGCTATTCGAAGCGCTGCGGTGGCTGGAGTGCGCGCATCCGGCGCAACCGCGTCTGGGCCAGGC
AGCACGGCCGTTGGAAGAGCCTGTGCGTTTGGGCCAGCGCGCCTCGCTGGAATTTCCTCCGCGCGACATC
GACAGCGTGCACGCTGGCGTTGACGGTCGCCCGCCGACCCTGCGCACGCTGTCGCTGGGCTTGTTCGGCC
CGCATGGTGCGCTGCCGTTGCACCTGACCGAGCACGCCATCGAACGTGAAAGCGCTGGCGATCCCACCTT
TGCGGCCTTTGCAGACATGTTTCACCATCGCATGATTGCGCTGTGGTATCGCGCCTGGGCCGATGCGCGA
CCCACCGTGCAGATGGATCGCGTGGGCGATGACCGCTTCGGCGCGCGGCTGGATGCGTTAACCGGTGTGG
ACCAACCTGCGTTACGTGATCGCGATGCGATGCCGGTGGCTGCACGCCGCCACTTCGCCGGTCGCTTCAT
TGCCCAGGCGCGCAATGCGGAAGGCTTGCGTGCTGTGCTGACCGGCCTGTTCGACGTCCCGGTGCAGGTG
CAGGAATTCGTTGCCAACTGGTTGACGCTGCCCGAGGAAGGGCGATTGCGGATGGGACGTGCTGCTGCGC
GTATCGGGCGTGACGCCACGCTTGGCGCATCGGCGCGCAACGCGCAGCATCGCTTCCGCCTGCGGATCGG
CCCCTTGGAGATCGCCCGCTACCGCGAGTTCCTGCCGGGCGGCCAGGCCCTGGACGTACTGACCGCCGCA
GTACGCGGCTACATCGGCGACGAGCAGGCCTGGGACTTACAACTCGTGCTGGCGCGCGAAGACGTCCCGT
TGCCAGTCCTGGGGCAGGGCCAGCGCATCGGCCTGTCGCTGTGGCTCGGCCACTATCGCCGCCCGCTCGA
TGCCGACCAGCTCGTGCTTACGTCGCCCTGA