SecReT6
Protein ID: 188575815
SecReT6 ID286
T6SS typei3
Gene symbolclpB
Locus tagPXO_00259
StrainXanthomonas oryzae pv. oryzae PXO99A
Repliconchromosome [GenBank: NC_010717] [Browse all T6SS(s) in this replicon]
Location [Strand]1599404..1602109 [+]
Productchaperone ClpB
NoteTssH
UniProt IDB2STG7
KEGG IDxop:PXO_00259
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.80E-40, Aligned region: 225..244
AAA_2 [PF07724], Evalue: 3.80E-40, Aligned region: 633..799
AAA [PF00004], Evalue: 2.80E-17, Aligned region: 225..337
AAA [PF00004], Evalue: 2.80E-17, Aligned region: 639..723
ClpB_D2-small [PF10431], Evalue: 9.30E-15, Aligned region: 806..881
AAA_16 [PF13191], Evalue: 1.40E-12, Aligned region: 128..166
AAA_16 [PF13191], Evalue: 1.40E-12, Aligned region: 202..248
AAA_16 [PF13191], Evalue: 1.40E-12, Aligned region: 269..303
AAA_16 [PF13191], Evalue: 1.40E-12, Aligned region: 609..681
AAA_16 [PF13191], Evalue: 1.40E-12, Aligned region: 703..725
AAA_5 [PF07728], Evalue: 5.70E-12, Aligned region: 225..245
AAA_5 [PF07728], Evalue: 5.70E-12, Aligned region: 638..756
Sigma54_activat [PF00158], Evalue: 3.40E-07, Aligned region: 203..247
Sigma54_activat [PF00158], Evalue: 3.40E-07, Aligned region: 637..751
Zeta_toxin [PF06414], Evalue: 8.60E-06, Aligned region: 224..247
Zeta_toxin [PF06414], Evalue: 8.60E-06, Aligned region: 637..678
Zeta_toxin [PF06414], Evalue: 8.60E-06, Aligned region: 811..843
AAA_22 [PF13401], Evalue: 1.20E-05, Aligned region: 224..248
AAA_22 [PF13401], Evalue: 1.20E-05, Aligned region: 357..391
AAA_22 [PF13401], Evalue: 1.20E-05, Aligned region: 636..661
AAA_22 [PF13401], Evalue: 1.20E-05, Aligned region: 700..722
AAA_14 [PF13173], Evalue: 5.20E-05, Aligned region: 225..293
AAA_14 [PF13173], Evalue: 5.20E-05, Aligned region: 331..391
AAA_14 [PF13173], Evalue: 5.20E-05, Aligned region: 637..748
NACHT [PF05729], Evalue: 5.30E-05, Aligned region: 225..253
NACHT [PF05729], Evalue: 5.30E-05, Aligned region: 638..665
AAA_17 [PF13207], Evalue: 7.60E-05, Aligned region: 225..249
AAA_17 [PF13207], Evalue: 7.60E-05, Aligned region: 500..546
AAA_17 [PF13207], Evalue: 7.60E-05, Aligned region: 638..676
AAA_25 [PF13481], Evalue: 0.00018, Aligned region: 220..301
AAA_25 [PF13481], Evalue: 0.00018, Aligned region: 351..391
AAA_25 [PF13481], Evalue: 0.00018, Aligned region: 636..663
Arch_ATPase [PF01637], Evalue: 0.00026, Aligned region: 203..245
Arch_ATPase [PF01637], Evalue: 0.00026, Aligned region: 637..679
Arch_ATPase [PF01637], Evalue: 0.00026, Aligned region: 704..720
IstB_IS21 [PF01695], Evalue: 0.0011, Aligned region: 218..247
IstB_IS21 [PF01695], Evalue: 0.0011, Aligned region: 638..657
AAA_18 [PF13238], Evalue: 0.0019, Aligned region: 225..245
AAA_18 [PF13238], Evalue: 0.0019, Aligned region: 639..669
DUF815 [PF05673], Evalue: 0.0053, Aligned region: 202..300
DUF815 [PF05673], Evalue: 0.0053, Aligned region: 637..676
AAA_29 [PF13555], Evalue: 0.0057, Aligned region: 217..240
AAA_29 [PF13555], Evalue: 0.0057, Aligned region: 636..663
Protein Sequence: 901 a.a.     [Download]
>gi|188575815|ref|YP_001912744.1| clpB gene product [Xanthomonas oryzae pv. oryzae PXO99A]
MADISRAALFGKLNKTTYRGIESATAFCRLRGDHEVELLHWLHQLLQAQDGDLHRIVRRFSLDASRLAQD
LTVALDRLPRGGGGHFDLSASVEEAVERAWVHCTLRYGRQRIRGGDLLVAILHARSLRHGLLAMSSEFAK
LRAEALADDLDDIVAGSPEDDATDVAAAVAPVGTGATGGTAALALYTVDLTAQAREGKLDPIIGRDEEIR
QVVDILMRRRQNNPILVGEAGVGKTAVVEGFAQRIARGDVPPALQDVQLRTLDVGLLQAGASMKGEFEQR
LRAVIDEVQASPKPIILFVDETHTLVGAGGAAGTGDAANLLKPALARGTLRTVGATTFAEYKKYIEKDPA
LTRRFQAVQVDEPDEAKAVRMMRGVASTMEQHHRVQILDEALEAAVKLSHRYIPARQLPDKSVSLLDTAC
ARVAVSLHATPAEVDDSRRRIESLDTEHAIIERERAIGIVVDERAAACASLLQSEHGRLRELEQRWVAEK
ALVDALLSLRAQLRGGNAPVEGTGSALETEAEQRASGDIAVLETPVHVDRDALLARLQLVQAELAALQGE
SPLILPTVDYQAVAAVVADWTGIPVGRMARNEIDTVLRLPELLAKRVIGQDHAMEMIAKRIQTSRAGLDN
PDKPIGVFLLAGTSGVGKTETALALAETLYGGEQNLITINMSEYQEAHTVSSLKGAPPGYVGYGEGGVLT
EAVRRKPYAVVLLDEVEKAHPDVHELFFQVFDKGWMEDGEGRRIDFRNTLIILTSNAGTDLIASLCKDPE
LMPDPDGMAKALREPLLKVFPPALLGRLVAIPYYPLSNAMLGQIVRLQLNRIKQRIEERYRIPFDYDESV
VELVVSRCTESESGGRMIDAILTNSMLPEISRKFLRGVVDRKRTERLDIRVEDSALVYSFL
 
Nucleotide Sequence: 2706 bp     [Download]
>gi|188574270|ref|NC_010717.1|:1599404-1602109 Xanthomonas oryzae pv. oryzae PXO99A chromosome, complete genome
ATGGCAGACATCAGTCGCGCCGCCTTGTTCGGCAAGCTCAACAAGACCACCTATCGCGGTATCGAATCGG
CCACTGCGTTCTGCAGGCTACGTGGCGACCACGAAGTGGAACTGCTGCACTGGCTGCATCAGTTGCTGCA
GGCGCAAGACGGCGACTTGCACCGCATCGTGCGCCGTTTTTCGCTGGATGCGTCGCGGCTTGCACAGGAC
CTGACCGTGGCGCTCGATCGCCTGCCGCGCGGCGGTGGCGGACACTTCGATCTGTCGGCCAGCGTGGAGG
AGGCAGTGGAACGCGCCTGGGTGCACTGCACGTTGCGTTACGGGCGGCAACGCATCCGTGGCGGCGATCT
GCTGGTAGCGATCCTGCACGCGCGTAGCCTGCGTCACGGGTTGCTGGCGATGTCGAGCGAGTTCGCCAAG
CTGCGCGCGGAAGCACTGGCGGACGATCTGGATGACATCGTCGCCGGCTCGCCGGAAGACGATGCCACCG
ACGTTGCGGCGGCTGTCGCCCCCGTTGGGACTGGCGCAACAGGTGGTACTGCGGCGCTCGCGCTGTACAC
GGTCGACCTCACCGCACAAGCGCGCGAGGGCAAGCTGGACCCGATCATCGGCCGCGACGAGGAGATTCGC
CAGGTCGTCGATATCCTGATGCGGCGCCGCCAGAACAACCCGATCCTGGTTGGCGAGGCCGGCGTCGGCA
AGACCGCGGTGGTGGAAGGCTTCGCACAACGTATCGCGCGCGGCGATGTGCCGCCCGCGTTGCAGGATGT
GCAGCTGCGCACGCTCGATGTCGGCTTGCTGCAAGCCGGCGCCAGCATGAAAGGTGAGTTCGAGCAGCGC
TTGCGCGCAGTCATCGACGAAGTGCAGGCCAGCCCCAAGCCGATCATTCTGTTCGTGGATGAAACCCATA
CCCTGGTCGGCGCCGGTGGCGCGGCCGGCACCGGCGATGCGGCCAACCTGCTCAAGCCGGCACTGGCGCG
CGGCACCTTGCGCACCGTAGGCGCGACCACCTTTGCCGAGTACAAAAAGTACATCGAAAAAGACCCTGCA
TTGACGCGGCGCTTCCAGGCCGTGCAGGTCGACGAGCCGGACGAGGCCAAGGCCGTGCGGATGATGCGCG
GTGTCGCCTCGACGATGGAACAGCACCACCGCGTGCAGATCCTTGACGAAGCGCTGGAAGCGGCGGTCAA
GCTCAGTCACCGCTACATCCCGGCGCGCCAGCTGCCAGACAAATCGGTCAGTCTGCTCGATACCGCCTGC
GCGCGCGTCGCGGTGAGCCTGCATGCCACGCCTGCGGAAGTGGACGACAGCCGTCGCCGCATCGAATCGC
TGGACACCGAGCACGCCATCATCGAGCGCGAGCGTGCGATTGGCATCGTGGTCGATGAGCGTGCTGCCGC
TTGCGCCAGCCTGCTGCAAAGCGAGCACGGCCGCCTGCGCGAGCTGGAACAGCGCTGGGTTGCCGAAAAG
GCGTTGGTCGATGCGCTGTTGTCGCTACGCGCGCAACTGCGAGGCGGCAACGCGCCGGTGGAAGGGACCG
GCAGTGCGTTGGAAACGGAGGCCGAACAGCGTGCGTCTGGCGATATCGCGGTGCTCGAAACGCCGGTACA
CGTGGATCGCGATGCGCTCTTAGCACGTTTGCAGTTGGTACAGGCCGAACTGGCCGCATTGCAGGGCGAA
TCGCCGCTGATCCTGCCCACAGTCGATTACCAAGCCGTGGCCGCGGTGGTCGCCGACTGGACCGGCATCC
CTGTCGGGCGCATGGCCCGCAACGAGATCGACACCGTGCTGCGCTTGCCCGAACTGCTGGCCAAGCGCGT
GATCGGCCAGGACCACGCCATGGAGATGATCGCCAAGCGGATCCAGACCAGCCGCGCCGGCCTGGACAAC
CCGGACAAACCGATCGGCGTGTTCCTGCTGGCCGGAACCTCCGGCGTCGGCAAGACCGAAACCGCACTCG
CCCTGGCCGAAACGCTGTACGGCGGCGAGCAAAACCTGATCACCATCAACATGAGCGAGTACCAAGAGGC
GCACACTGTCTCCTCGCTCAAGGGCGCACCGCCGGGCTATGTGGGCTACGGCGAAGGTGGCGTACTGACC
GAAGCGGTGCGCCGCAAGCCGTACGCGGTCGTGCTGCTGGACGAAGTGGAAAAAGCCCACCCGGACGTGC
ACGAACTGTTCTTCCAGGTCTTCGACAAGGGCTGGATGGAAGACGGCGAAGGCCGCCGCATCGACTTCCG
CAACACCTTGATCATCCTTACCAGCAACGCCGGCACCGACCTGATCGCCAGCCTGTGCAAGGACCCGGAA
TTGATGCCGGATCCGGACGGCATGGCCAAGGCATTGCGCGAACCGTTGTTGAAGGTGTTTCCGCCGGCAT
TGCTCGGGCGGCTGGTGGCGATTCCGTATTACCCGCTCAGTAACGCCATGCTCGGACAGATCGTGCGATT
GCAGTTGAACCGCATCAAGCAGCGGATCGAAGAGCGCTACAGGATTCCGTTCGACTACGACGAGTCTGTA
GTGGAGCTGGTGGTGAGCCGGTGTACCGAGAGCGAATCGGGTGGCCGGATGATCGATGCGATTTTGACTA
ACTCGATGTTGCCGGAGATTAGCCGCAAATTTCTTCGTGGGGTAGTGGACCGGAAACGGACTGAACGCCT
TGACATTCGTGTCGAAGATTCCGCATTGGTTTATTCGTTTCTCTGA