SecReT6
Protein ID: 188575818
SecReT6 ID286
T6SS typei3
Gene symbol-
Locus tagPXO_00256
StrainXanthomonas oryzae pv. oryzae PXO99A
Repliconchromosome [GenBank: NC_010717] [Browse all T6SS(s) in this replicon]
Location [Strand]1604466..1606403 [+]
ProductRhs-family protein
NoteTssI
UniProt IDB2STH0
KEGG IDxop:PXO_00256
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.60E-73, Aligned region: 23..328
Phage_base_V [PF04717], Evalue: 2.60E-21, Aligned region: 370..463
Protein Sequence: 645 a.a.     [Download]
>gi|188575818|ref|YP_001912747.1| unnamed protein product [Xanthomonas oryzae pv. oryzae PXO99A]
MAHAITLQSPLGKTLRFVRMSAHEALGRPYAFALHGISRDVAIDLRALLGKPMAVKVTSPQGYVRHYHGI
VAEAEQTGFEQIEGLRYATYAFSLVPKLWLLGQRRDCRIYKNKSVPELVRALLAEVGCTDVKLRLSASYT
PREYCVQYRESALDFISRLMEQEGIYYYFAHSASTHTLVLADSLGAHESSAPFAQIPYCPPGQKGSRMKD
AITDWSLARSAHSTRVRLDDYDYLKPKASLRVDETPAESSGPALGELDVFDYPGEHLDVAAGRRHAQVRA
EALNVAQAQYQGWTDACGLQVGALFKLRDFPLAEHNQEYLVTSADTELVEVDYVSGGQTVAEPFASTFRA
LRSRQPFRTPQTTPRPSIAGVQTALVDGNKAEDIAVDQYGRVQVNFFWSPPGTPNAVCSCPVRVAQSWAG
KRWGAQHIPRVGQEVVVSFLEGNPDRPLIIGSVYNADQLPPYALPEHRTRSGVKSRSLSGGAEDYNEIRF
DDKKGNEELLLHAQRDLRHEAENDHFVTVDRNETAEIKRERSHTVGGNDRLDVGKTLRIQAGSEIALVTG
MARLQLKASGEIVLSGTRLTLDGRVSVGIQGGVSVDVSAMANLTLRSNASVLLQSNAVTTARANAALLLQ
SSGPAVLKGTPPIIA
 
Nucleotide Sequence: 1938 bp     [Download]
>gi|188574270|ref|NC_010717.1|:1604466-1606403 Xanthomonas oryzae pv. oryzae PXO99A chromosome, complete genome
ATGGCCCACGCCATTACCCTGCAGTCGCCGCTTGGCAAGACGCTGCGCTTTGTGCGGATGAGCGCGCACG
AGGCACTGGGGCGGCCCTATGCGTTCGCGTTGCACGGCATCAGCCGCGATGTGGCGATCGACCTGCGCGC
TCTGCTGGGCAAGCCGATGGCGGTCAAGGTCACTTCACCGCAGGGCTATGTGCGGCATTACCACGGCATC
GTCGCCGAGGCGGAGCAGACCGGGTTCGAGCAGATCGAGGGGCTGCGCTACGCCACCTATGCCTTCTCGC
TGGTGCCCAAGCTGTGGTTGCTCGGGCAGCGCCGCGATTGCCGCATCTACAAGAACAAGAGCGTGCCGGA
GCTGGTGCGCGCGTTGCTGGCCGAGGTTGGATGCACCGACGTGAAGCTGCGCCTGAGCGCGAGCTACACG
CCGCGCGAATACTGCGTGCAGTACCGCGAGAGCGCGCTGGACTTCATCAGCCGCTTGATGGAGCAAGAGG
GCATCTACTACTACTTCGCACACAGTGCCAGCACGCATACGCTGGTGCTGGCCGACAGTCTCGGCGCGCA
CGAATCCTCTGCGCCATTCGCACAAATCCCTTACTGCCCGCCCGGGCAGAAGGGCAGCCGGATGAAGGAC
GCGATCACCGATTGGTCGCTGGCGCGCAGCGCGCACAGCACGCGCGTGCGCCTGGACGACTACGACTATC
TCAAGCCCAAGGCCTCGCTGCGGGTGGACGAGACACCGGCCGAGTCTTCGGGACCGGCGCTGGGCGAGCT
GGATGTGTTCGATTATCCCGGCGAGCATCTCGATGTCGCGGCCGGTCGTCGTCACGCGCAGGTGCGTGCC
GAAGCGCTCAACGTGGCGCAGGCGCAATACCAGGGCTGGACCGATGCCTGCGGTTTGCAGGTGGGCGCAT
TGTTCAAGCTGCGCGACTTTCCGCTGGCCGAGCACAACCAGGAATACCTGGTGACCAGCGCGGACACCGA
ACTGGTTGAAGTGGATTATGTGTCCGGTGGCCAGACGGTTGCCGAGCCGTTTGCGTCCACCTTCCGTGCG
CTACGCAGTCGGCAGCCGTTTCGGACCCCGCAGACCACGCCGCGTCCGAGTATTGCCGGGGTGCAGACCG
CGCTCGTCGACGGCAACAAGGCCGAGGATATTGCGGTCGATCAGTACGGCCGTGTGCAGGTGAATTTCTT
CTGGAGTCCGCCGGGAACGCCAAACGCCGTCTGCTCGTGCCCGGTACGCGTGGCGCAGTCGTGGGCGGGC
AAACGCTGGGGCGCGCAGCACATTCCGCGTGTGGGCCAGGAGGTGGTGGTGAGCTTTCTGGAAGGCAATC
CGGATCGTCCGCTGATCATCGGCAGCGTCTACAACGCCGACCAGCTGCCACCGTATGCACTGCCCGAGCA
CCGCACCCGTAGCGGGGTAAAGAGCCGCAGCCTGTCGGGTGGGGCAGAGGACTACAACGAGATCCGTTTC
GACGACAAGAAGGGCAACGAAGAGCTGCTGCTGCATGCGCAGCGCGATCTGCGCCACGAAGCGGAGAACG
ACCATTTCGTCACTGTCGACCGCAACGAAACCGCCGAGATCAAACGCGAACGCAGCCACACCGTTGGCGG
CAACGACCGTCTGGACGTGGGCAAGACACTCCGCATCCAGGCAGGGAGCGAGATCGCGTTGGTGACCGGG
ATGGCTCGCCTGCAGTTGAAGGCCAGCGGCGAGATCGTGCTCAGCGGCACCCGGCTCACGCTCGATGGAC
GCGTCAGCGTCGGCATCCAGGGTGGCGTCAGTGTCGATGTCAGCGCGATGGCCAACCTGACCCTGCGCTC
GAACGCGTCGGTGCTGCTGCAATCCAACGCCGTGACCACCGCGCGCGCCAACGCGGCGCTGCTGTTGCAG
TCGTCAGGTCCGGCCGTGCTCAAGGGCACTCCGCCCATCATCGCTTGA