SecReT6
Protein ID: 188575820
SecReT6 ID286
T6SS typei3
Gene symbol-
Locus tagPXO_00253
StrainXanthomonas oryzae pv. oryzae PXO99A
Repliconchromosome [GenBank: NC_010717] [Browse all T6SS(s) in this replicon]
Location [Strand]1606948..1608360 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDB2STH2
KEGG IDxop:PXO_00253
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.70E-14, Aligned region: 34..97
Protein Sequence: 470 a.a.     [Download]
>gi|188575820|ref|YP_001912749.1| unnamed protein product [Xanthomonas oryzae pv. oryzae PXO99A]
MSAVSPRLTLTVRDAQAVSGGTQAQASFAAEGGRIGRDATCDWVLEGEGVSRLHASVRHLDGVYFIEDHS
TNGVLHNGVPLRAGFPVPLHAGDALRIDAFEIDVAVSGASVTAGAAATQNWNHAEPCTLSAMPLPQQSQH
APLEHDVFAALGASSMRATDTDPLALFATSFTLAGRQSDAAAFGLGHAPATAEAYRAPVAAPAAGGVVLP
EHWDLTRSEFALPPAADPVADMQAPLPSAAVPIAPAAAAPAPTPTPTPTPLPLPLPLPTPVSQTRGAAVA
VSAAAPSAAQPVVAHTPDTPELPALFAAMTAGLMDVLRARAAFKNSLRVPVTLIQRTENNPLKFAATVDE
AVARLLAPPSPGYLTGAAAIEEAVEDIGRHQLALLAGMRAAFEHVFAQFDPARFEADTAGSALGSWGNRP
WRRYAQHYRELLGDPDERFRRLFGEEFARAYEQQLARAKAQAQPTDGDRA
 
Nucleotide Sequence: 1413 bp     [Download]
>gi|188574270|ref|NC_010717.1|:1606948-1608360 Xanthomonas oryzae pv. oryzae PXO99A chromosome, complete genome
ATGAGCGCGGTGTCACCCCGGCTGACGCTGACGGTTCGCGATGCGCAGGCGGTGTCGGGCGGCACACAAG
CGCAGGCCAGCTTCGCGGCAGAAGGCGGGCGCATCGGCCGCGACGCCACCTGCGATTGGGTGCTCGAAGG
CGAGGGGGTGTCGCGCCTGCACGCCAGCGTGCGCCATCTCGATGGGGTGTATTTCATCGAAGACCACAGC
ACTAACGGCGTGTTGCATAACGGCGTGCCGCTACGTGCCGGTTTTCCGGTGCCGCTGCATGCCGGCGACG
CCTTGCGCATCGATGCCTTCGAGATCGACGTGGCGGTGTCGGGCGCAAGCGTTACCGCTGGTGCAGCCGC
GACGCAGAACTGGAATCACGCCGAACCGTGCACGCTGTCGGCAATGCCACTGCCGCAGCAGTCGCAGCAC
GCGCCGCTGGAGCATGATGTTTTCGCCGCGCTTGGGGCGTCGTCGATGCGGGCAACCGACACCGACCCAC
TGGCATTGTTCGCCACCTCGTTCACGCTGGCCGGCCGCCAGAGCGATGCGGCGGCGTTCGGGCTGGGGCA
TGCGCCGGCAACGGCCGAGGCCTACCGTGCACCCGTGGCCGCGCCGGCTGCCGGCGGCGTTGTGTTGCCC
GAGCACTGGGACCTGACACGCAGCGAATTTGCGCTGCCGCCGGCTGCCGATCCAGTGGCAGACATGCAAG
CGCCACTGCCGTCCGCCGCAGTGCCTATTGCCCCAGCGGCGGCAGCACCCGCACCGACGCCCACACCCAC
ACCCACACCACTGCCACTGCCACTGCCACTGCCAACGCCGGTCTCGCAAACGCGTGGCGCGGCAGTAGCG
GTGAGCGCTGCCGCCCCCTCCGCGGCGCAGCCGGTAGTTGCACACACGCCGGATACCCCCGAGCTGCCCG
CGCTGTTCGCCGCCATGACCGCTGGCTTGATGGATGTCTTGCGCGCGCGTGCGGCGTTCAAGAACAGCCT
CCGCGTGCCGGTCACGCTGATCCAACGCACCGAGAACAATCCGCTCAAGTTCGCCGCGACGGTGGACGAG
GCGGTCGCCCGCCTGTTGGCGCCGCCGAGCCCTGGGTATCTGACCGGTGCGGCCGCGATCGAAGAAGCGG
TGGAGGACATCGGGCGTCACCAGCTGGCCTTGTTGGCCGGCATGCGTGCCGCCTTCGAGCATGTGTTTGC
CCAGTTCGATCCAGCGCGCTTCGAGGCAGACACCGCCGGCTCCGCGCTCGGTTCCTGGGGCAATCGGCCC
TGGCGACGCTACGCGCAGCATTACCGCGAGTTGCTCGGCGATCCCGACGAGCGCTTCCGCCGCCTGTTCG
GCGAAGAATTCGCCCGCGCCTACGAACAACAGCTGGCCCGTGCCAAGGCGCAGGCTCAACCCACAGACGG
CGACCGAGCATGA