SecReT6
Protein ID: 188575821
SecReT6 ID286
T6SS typei3
Gene symbolimpJ
Locus tagPXO_00252
StrainXanthomonas oryzae pv. oryzae PXO99A
Repliconchromosome [GenBank: NC_010717] [Browse all T6SS(s) in this replicon]
Location [Strand]1608357..1609694 [+]
Productprotein ImpJ
NoteTssK
UniProt IDB2STH3
KEGG IDxop:PXO_00252
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.30E-151, Aligned region: 19..444
Protein Sequence: 445 a.a.     [Download]
>gi|188575821|ref|YP_001912750.1| impJ gene product [Xanthomonas oryzae pv. oryzae PXO99A]
MTPYNKVIWSEGLFLRPQHLQQQERYLERYMELHAGALRPHAWGFSVLELEPELLSIGKLGIRRARGCFP
DGTPFSIPDRDPAPPPLDVPANCRDQVVSLALPLRATTQPDSTWPDGDGSRLARYRVGEAEVGDSSGSIA
GTVLLEVGVLASRLRLQSEPGEGLVEVPMARIVECRADRRVILDDAFIPTAIRIEGAARLSMLLAELLGL
LHQRGQALADRVAGSDRRGVAEIADVLMLQVINRYQPLVAHWASAPLEHPEALYCVLLGMAGELATFTRA
SKRSGPFPPYAHDALQASFEPVVVSLRESLSAVLEQSAIAVPLQQRKYGVWVGMVPDPALLDAAAFVLAV
KADLRAEDLRKRLPAESKIGPVEKIRDLVNLQLPGVAVSALAMAPRQVPYHAGCAYFELDRQSSLWKTLR
TSGGVALHFGSGFPGLELELWAVRN
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|188574270|ref|NC_010717.1|:1608357-1609694 Xanthomonas oryzae pv. oryzae PXO99A chromosome, complete genome
ATGACCCCTTACAACAAGGTGATCTGGAGCGAGGGCCTGTTCCTGCGCCCGCAGCACCTGCAACAACAGG
AGCGCTATCTGGAGCGCTACATGGAACTGCATGCCGGTGCGCTCCGGCCGCATGCGTGGGGTTTCAGCGT
ACTGGAGCTGGAGCCGGAATTGCTGTCCATCGGCAAGCTCGGCATCCGGCGCGCCCGCGGCTGCTTTCCC
GATGGCACGCCGTTTTCCATTCCCGATCGCGATCCGGCACCGCCGCCGTTGGACGTGCCGGCCAACTGCC
GCGACCAGGTGGTGAGTCTGGCGCTGCCGCTGCGCGCGACCACGCAGCCCGATAGCACCTGGCCGGATGG
CGACGGCAGCCGGCTGGCCCGTTATCGCGTGGGCGAAGCGGAGGTCGGCGATTCGTCCGGCAGCATCGCC
GGCACGGTCCTGCTGGAAGTCGGCGTGCTGGCCAGTCGCCTACGCCTGCAGTCCGAACCGGGGGAGGGGC
TGGTGGAGGTGCCGATGGCGCGCATTGTCGAGTGCCGCGCCGATCGACGGGTGATTCTCGATGATGCCTT
CATCCCGACCGCCATCCGCATCGAAGGCGCCGCGCGGTTGTCCATGCTGCTGGCCGAATTGCTTGGGCTA
TTGCATCAACGCGGCCAGGCGCTGGCCGACCGCGTGGCCGGCAGCGACCGTCGCGGCGTGGCGGAAATCG
CAGACGTGCTGATGTTGCAGGTGATCAATCGCTACCAGCCGCTGGTGGCGCATTGGGCAAGCGCGCCGCT
GGAGCATCCGGAAGCGCTGTATTGCGTGCTGCTGGGGATGGCTGGCGAACTCGCGACCTTCACCCGTGCC
AGTAAACGCAGCGGGCCATTTCCGCCGTACGCACACGATGCGCTGCAGGCGAGCTTCGAGCCGGTGGTGG
TGTCCTTGCGCGAAAGCTTGAGCGCGGTGCTCGAACAGTCGGCGATTGCCGTGCCCTTGCAGCAACGCAA
ATACGGCGTGTGGGTGGGCATGGTGCCCGATCCGGCCTTGCTGGACGCGGCGGCCTTCGTGCTGGCAGTC
AAGGCGGATCTGCGCGCCGAGGATCTGCGCAAGCGGCTACCCGCCGAATCGAAGATCGGCCCGGTGGAGA
AGATTCGCGACCTGGTGAACCTGCAACTGCCCGGGGTGGCCGTGAGTGCGCTGGCGATGGCACCGCGGCA
GGTGCCGTATCACGCCGGCTGCGCCTACTTCGAACTCGATCGGCAATCGTCGCTGTGGAAGACGCTGCGC
ACGTCCGGTGGCGTGGCGCTGCATTTCGGCAGTGGTTTTCCCGGCCTGGAACTTGAGTTGTGGGCGGTGA
GGAATTGA