SecReT6
Protein ID: 188575822
SecReT6 ID286
T6SS typei3
Gene symbolompA
Locus tagPXO_00251
StrainXanthomonas oryzae pv. oryzae PXO99A
Repliconchromosome [GenBank: NC_010717] [Browse all T6SS(s) in this replicon]
Location [Strand]1609696..1611012 [+]
ProductOmpA family membrane protein
NoteTssL
UniProt IDB2STH4
KEGG IDxop:PXO_00251
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.50E-65, Aligned region: 57..262
OmpA [PF00691], Evalue: 2.90E-15, Aligned region: 329..419
Protein Sequence: 438 a.a.     [Download]
>gi|188575822|ref|YP_001912751.1| ompA gene product [Xanthomonas oryzae pv. oryzae PXO99A]
MSKTVDQHDDDATVVRSATPAPRPAASMPPRQAPTRTRRPPDLDAAMRATPGAMQGNAVVRAATPLLLLA
VQLRHSAQTPEIATLRENCVTRLQHFEQELRQQGTDDKTGIAARYVLCTLLDEAVLAAPWGEASGWSQRT
LLVTFHGETYGGAKVFDLLDRLARDPARHLDLLELLYLALALGFGGRYRVEQGGGARLADRQAELYQLIQ
RQRLPAPAELSPHWQGAQAPLLRNAAATPLWIAALASLCIVLLAFVWLHARLNTLTAPISAQLARIGLER
VALPIPAAVRAATIPALAPLLAAEQRAGLLTVHTDGDGRSTVRLASASMFPSGSAELDADQTHLLERVAA
ALEQVPGRVVVVGHTDDQPVRSLRFKDNFALSARRAESVGAVLAAGLRDRRRVQTSGAGDSQPIALPPQL
PGNRARNRRVEILLIPET
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|188574270|ref|NC_010717.1|:1609696-1611012 Xanthomonas oryzae pv. oryzae PXO99A chromosome, complete genome
ATGAGCAAGACGGTCGACCAGCACGACGACGATGCCACCGTGGTCCGCAGCGCGACGCCGGCGCCGCGGC
CCGCCGCATCCATGCCGCCCCGCCAAGCACCGACGCGGACGAGGCGACCGCCCGATCTGGATGCCGCCAT
GCGCGCGACGCCAGGTGCGATGCAGGGCAATGCGGTGGTGCGCGCAGCCACGCCGCTGCTGCTGCTGGCG
GTGCAGTTGCGACACTCCGCGCAGACGCCGGAGATCGCCACCTTGCGCGAGAACTGCGTCACGCGCCTGC
AGCACTTCGAGCAGGAGCTGCGGCAACAGGGCACCGACGACAAGACCGGCATCGCCGCGCGCTACGTGCT
GTGCACGTTGCTCGACGAAGCGGTGCTGGCCGCGCCCTGGGGCGAGGCCAGCGGCTGGTCGCAGCGCACT
TTGCTGGTGACGTTCCACGGCGAAACCTATGGCGGCGCCAAGGTCTTCGACCTGCTCGATCGGCTGGCAC
GCGATCCGGCGCGGCACCTGGACCTGCTGGAGCTGCTGTACCTGGCATTGGCGCTGGGCTTTGGTGGCCG
CTATCGGGTGGAGCAGGGTGGTGGGGCACGGCTGGCCGATCGCCAGGCCGAGCTCTACCAACTCATCCAG
CGTCAGCGCTTGCCTGCGCCTGCCGAGTTGTCGCCGCATTGGCAAGGCGCGCAGGCGCCGTTGCTGCGCA
ATGCAGCGGCCACGCCGCTGTGGATCGCGGCGCTGGCCTCGCTGTGCATCGTGTTGCTGGCGTTCGTGTG
GTTGCATGCGCGCCTCAATACGCTGACCGCGCCGATCAGCGCGCAGCTGGCGCGCATCGGCCTGGAGCGG
GTGGCGTTGCCGATCCCGGCGGCAGTCAGAGCGGCGACCATACCGGCGCTTGCACCGCTGCTGGCGGCCG
AGCAACGCGCAGGGTTGCTGACCGTCCACACCGACGGCGATGGCCGCAGCACCGTGCGCCTGGCCAGCGC
ATCCATGTTCCCCAGCGGCAGCGCGGAGTTGGATGCCGATCAGACCCACCTGCTCGAACGCGTTGCTGCG
GCGCTTGAACAGGTGCCGGGGCGGGTGGTGGTGGTGGGGCATACCGACGATCAGCCGGTGCGCTCGCTGC
GCTTCAAGGACAACTTCGCCTTATCCGCACGTCGCGCAGAGAGCGTGGGCGCCGTGTTGGCGGCAGGCCT
GCGCGATCGACGCCGGGTACAGACCAGTGGCGCGGGCGATTCCCAGCCCATCGCGCTACCGCCGCAATTG
CCCGGCAACCGTGCGCGCAATCGGCGCGTCGAGATCCTGTTGATTCCCGAGACCTGA