SecReT6
Protein ID: 188575828
SecReT6 ID286
T6SS typei3
Gene symbol-
Locus tagPXO_00245
StrainXanthomonas oryzae pv. oryzae PXO99A
Repliconchromosome [GenBank: NC_010717] [Browse all T6SS(s) in this replicon]
Location [Strand]1619233..1620261 [-]
ProductImpA-related N-terminal family
NoteTssA
UniProt IDB2STI0
KEGG IDxop:PXO_00245
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.50E-20, Aligned region: 54..114
Protein Sequence: 342 a.a.     [Download]
>gi|188575828|ref|YP_001912757.1| unnamed protein product [Xanthomonas oryzae pv. oryzae PXO99A]
MQIDNAPLLRPVDEQVPSGPNLEYTPEFQSLEELARPRQERALGAGVLVPDAPQWRQVAESAEHLLGRSK
DLRLGILLSIARLHQDGLVGWSSGVGLLRQLLEQFWGDVHPHLDADEDNDPTERVNAIAALADSERTLTQ
LRNVRLFKGLHPGHFSLRDLRIVQGTLKLAAEDASEIPEPAAIDACLRDCPLEALLDLDAALAAAQDDIA
AIAGVFAERTPGHGPELAPLTQDLDELRAFLRPYVSERSGSPAEPTEHAAPGADTVRTSTPRAHAVEHPD
EVRRMLDQLCDYYARREPSSPVPLLLRRAQRLVGLDFTALIRDLAPRAIEELQVVSGQDHSD
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|188574270|ref|NC_010717.1|:c1620261-1619233 Xanthomonas oryzae pv. oryzae PXO99A chromosome, complete genome
ATGCAGATCGACAACGCACCGTTGCTGCGACCGGTCGACGAACAGGTGCCATCCGGTCCGAACCTGGAAT
ACACCCCGGAGTTCCAGAGCCTGGAGGAACTTGCACGACCGCGTCAGGAGCGCGCCTTGGGCGCTGGCGT
GCTTGTGCCCGACGCGCCGCAATGGCGCCAGGTCGCCGAGAGCGCCGAACACTTGCTAGGGCGCTCCAAG
GACTTGCGGCTGGGCATCTTGCTGAGCATCGCCCGCTTGCACCAGGACGGTCTGGTGGGCTGGTCCAGCG
GCGTCGGCCTGCTCCGACAACTGCTGGAGCAGTTCTGGGGCGACGTCCATCCTCATCTGGATGCCGATGA
AGACAACGACCCGACCGAACGCGTCAACGCCATCGCTGCGTTGGCCGACAGCGAGCGCACGCTGACACAG
CTGCGCAACGTGCGCCTATTCAAGGGACTGCATCCAGGACATTTCTCGCTGCGCGATCTGCGCATCGTGC
AAGGCACGCTCAAGCTCGCTGCGGAGGACGCGAGCGAGATACCAGAGCCTGCCGCCATCGATGCCTGCCT
GCGCGACTGCCCGCTGGAGGCGTTGCTTGATCTGGACGCGGCCCTGGCCGCTGCGCAGGACGACATTGCC
GCAATTGCCGGCGTGTTCGCCGAGCGCACTCCGGGGCACGGTCCGGAGCTGGCACCGCTCACGCAGGATC
TGGACGAGTTGCGTGCGTTCCTGCGGCCCTATGTGTCCGAACGTTCCGGATCCCCGGCCGAGCCGACCGA
ACATGCAGCACCGGGCGCCGACACTGTCAGGACATCGACGCCACGCGCGCACGCCGTGGAGCATCCGGAC
GAGGTTCGCCGCATGCTCGACCAGCTCTGCGATTACTACGCGCGGCGCGAGCCCTCCAGCCCGGTGCCGT
TACTGTTGCGGCGCGCACAACGCCTGGTCGGCCTGGATTTCACCGCACTGATACGCGATCTCGCGCCGCG
CGCGATTGAAGAGCTGCAAGTGGTGTCGGGCCAGGACCATTCCGACTAG