SecReT6
Protein ID: 188577919
SecReT6 ID287
T6SS typei4b
Gene symbol-
Locus tagPXO_02060
StrainXanthomonas oryzae pv. oryzae PXO99A
Repliconchromosome [GenBank: NC_010717] [Browse all T6SS(s) in this replicon]
Location [Strand]3845766..3846431 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDB2SI74
KEGG IDxop:PXO_02060
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.40E-32, Aligned region: 10..147
Phage_GPD [PF05954], Evalue: 1.40E-32, Aligned region: 201..220
Protein Sequence: 221 a.a.     [Download]
>gi|188577919|ref|YP_001914848.1| unnamed protein product [Xanthomonas oryzae pv. oryzae PXO99A]
MLVAETLNGRESVDGGGFRFDVGALSANAGLPLDALLGQPVLLELLTAESHTALRPFHGHVTAFERLGSN
GGLARYRLRVEPWLALLAQRVDSYVFQDMSVVEIAESVFADYAGQGALAPAWRWELSDRSTYARRSLTTQ
YEETDFAQDADDLFFGKTLLHVQSPRGRELDSQLRCYSNLGGRRGRQRRRPPPAAVAAAAVNSTRGRALP
RHRHRAARRRS
 
Nucleotide Sequence: 666 bp     [Download]
>gi|188574270|ref|NC_010717.1|:3845766-3846431 Xanthomonas oryzae pv. oryzae PXO99A chromosome, complete genome
GTGCTGGTTGCCGAGACCCTGAACGGCCGCGAGTCGGTCGACGGCGGCGGCTTCCGCTTCGACGTGGGCG
CACTATCGGCCAACGCCGGCCTGCCCCTGGACGCGCTGCTCGGCCAGCCGGTGCTGCTGGAACTGCTCAC
CGCCGAATCGCACACCGCGCTGCGCCCGTTCCACGGCCATGTCACCGCGTTCGAACGCCTCGGCAGCAAC
GGGGGCCTGGCGCGCTACCGGCTGCGGGTGGAGCCGTGGCTGGCGCTGCTGGCCCAGCGTGTGGACAGCT
ACGTGTTCCAGGACATGAGCGTGGTGGAGATCGCCGAGAGCGTGTTCGCCGACTACGCCGGGCAAGGCGC
GCTGGCGCCGGCGTGGCGCTGGGAGCTGTCCGACCGCAGCACGTACGCCAGGCGCAGCCTGACCACGCAA
TACGAAGAGACAGACTTCGCGCAGGACGCCGATGATCTGTTCTTCGGAAAAACGCTTCTTCACGTCCAAT
CTCCTCGGGGTAGGGAATTGGACTCCCAACTGAGGTGCTACTCAAACTTGGGGGGACGTCGTGGGCGGCA
ACGCCGCCGGCCGCCACCGGCAGCAGTTGCTGCAGCAGCCGTGAACTCGACTCGCGGGCGCGCGTTGCCA
AGGCATCGGCACCGCGCAGCTCGCCGACGCTCTTGA