SecReT6
Protein ID: 188577925
SecReT6 ID287
T6SS typei4b
Gene symbol-
Locus tagPXO_02054
StrainXanthomonas oryzae pv. oryzae PXO99A
Repliconchromosome [GenBank: NC_010717] [Browse all T6SS(s) in this replicon]
Location [Strand]3855024..3857573 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDB2SI80
KEGG IDxop:PXO_02054
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.00E-63, Aligned region: 13..284
Phage_GPD [PF05954], Evalue: 3.00E-63, Aligned region: 758..785
DUF2345 [PF10106], Evalue: 4.70E-37, Aligned region: 573..589
DUF2345 [PF10106], Evalue: 4.70E-37, Aligned region: 652..815
T6SS_Vgr [PF13296], Evalue: 5.60E-27, Aligned region: 129..166
T6SS_Vgr [PF13296], Evalue: 5.60E-27, Aligned region: 222..252
T6SS_Vgr [PF13296], Evalue: 5.60E-27, Aligned region: 508..612
Phage_base_V [PF04717], Evalue: 1.70E-19, Aligned region: 154..179
Phage_base_V [PF04717], Evalue: 1.70E-19, Aligned region: 363..466
Phage_base_V [PF04717], Evalue: 1.70E-19, Aligned region: 742..782
Protein Sequence: 849 a.a.     [Download]
>gi|188577925|ref|YP_001914854.1| unnamed protein product [Xanthomonas oryzae pv. oryzae PXO99A]
MLLELLTAESHTALRPFHGHVTAFERLGSNGGLARYRLVVEPWLALLAQRVDSYVFQDMSVVEIAESVFA
DYAGQGALAPAWRWELSDRSTYARRSLTTQYEETDFAFLSRLLAEEGIAYWFEHTGAADSATRGTHTLVL
SDHNAAFADLGTVRYHRTDVTEQQDSVQQWVQAHRWRATSLSRASWDYRSRSLRLAGAEGTPLGDIGAED
VDTAGPYGWQDSTRGQRRAQQHLDAQQVTAQTIQGQGTWRQLAPGTRFGLRQHAVVAADAAFLCLQVRHQ
ARNNLGAEVFDALEQALGAVAVAGAPLPPALAGLSGGYAPAQDEAAVEFYRNQFTAIPATATYRPQTEDG
HGVRLHPKPTVVGTLSAIVVSDGDPVQSDRDHRIKVQFPFQRGADASSALAHPGGEDNAPGSASAWTWVR
VMTPWAGDNWGGVVLPRKGQEVLVGFLEGDIDRPVVIGSVYNGRGQDEAAHNQVGGGGAGATGNAPAWFQ
GNAHGAVFTGFKSQALAQSQDGTGGYQQLRLDDTPGQGRAQLSTTQHASSLTLGHLKGGHDNLREGERGY
GADLSTQAYGAVRAGQGLLLSSEPGNTQLAATGALSQLQQGSDLLKRLNDAARTQQAGLPSEPESLPTQD
GLKTLQDHLQATHTGSAAGEIGGGAGEVPGWSAPVLLGSGQAGVMSLTPADQVWVSGTQTALLAGSALNW
LSQGHLVLAVAGGLVLYTQGGDPVAGSPNQERGIALHAAQGTLSARAHKNTATLAAKTQVRIVSTTADVQ
LTAPTRHLLATAAGAYIKLDGDDIELGAPGVVAFKGGQQVLTAPQGASMSPVTPSASHKLCEYTARAADF
AGAGTMGAA
 
Nucleotide Sequence: 2550 bp     [Download]
>gi|188574270|ref|NC_010717.1|:c3857573-3855024 Xanthomonas oryzae pv. oryzae PXO99A chromosome, complete genome
GTGCTGCTGGAACTGCTCACCGCCGAATCGCACACCGCGCTGCGCCCGTTCCACGGCCATGTCACCGCGT
TCGAGCGGCTTGGCAGCAACGGCGGCCTGGCGCGCTACCGGCTGGTGGTGGAGCCGTGGCTGGCGCTGCT
GGCCCAGCGCGTGGACAGCTACGTGTTCCAGGACATGAGCGTGGTGGAGATCGCCGAGAGCGTATTCGCC
GACTACGCCGGGCAAGGCGCGCTGGCGCCGGCGTGGCGTTGGGAGCTGTCCGACCGCAGCACGTACGCCA
GGCGCAGCCTGACCACGCAATACGAAGAGACCGACTTCGCGTTCCTGAGCCGGCTGCTGGCCGAGGAAGG
CATCGCCTATTGGTTCGAGCACACCGGCGCAGCCGACAGCGCCACGCGCGGCACGCACACGCTGGTGCTG
TCGGACCATAACGCCGCCTTCGCCGACCTGGGCACGGTGCGCTACCACCGCACCGACGTCACCGAGCAGC
AGGACAGCGTGCAGCAGTGGGTACAGGCACATCGCTGGCGCGCGACCAGTCTGTCGCGGGCCAGCTGGGA
CTACCGCAGCCGCAGCCTGCGCCTGGCCGGCGCCGAAGGCACGCCGCTGGGCGACATCGGTGCCGAGGAC
GTGGACACCGCCGGCCCCTACGGCTGGCAGGACAGCACGCGCGGCCAGCGCCGCGCGCAGCAGCATCTGG
ATGCGCAGCAGGTGACGGCGCAGACCATCCAGGGCCAGGGGACCTGGCGGCAACTGGCGCCGGGCACGCG
TTTCGGGCTGCGCCAGCATGCGGTCGTGGCGGCCGATGCGGCGTTTCTGTGCCTGCAGGTGCGGCACCAG
GCGCGCAACAACCTGGGCGCGGAGGTGTTCGACGCGCTGGAGCAGGCGCTGGGCGCGGTGGCGGTGGCCG
GCGCGCCGCTGCCGCCAGCGCTGGCAGGCCTGAGCGGCGGGTATGCGCCGGCGCAGGATGAGGCGGCGGT
AGAGTTCTACCGCAACCAGTTCACCGCCATACCGGCCACCGCGACCTACCGGCCGCAAACCGAGGACGGC
CACGGCGTGCGCCTGCATCCCAAGCCCACGGTGGTCGGCACGCTGAGCGCGATCGTGGTCAGCGACGGCG
ACCCGGTGCAGTCCGACCGCGACCACCGGATCAAGGTGCAGTTCCCGTTCCAGCGCGGGGCCGACGCCAG
CAGCGCGCTGGCGCATCCGGGGGGCGAGGACAACGCGCCGGGCAGCGCCTCGGCGTGGACCTGGGTGCGG
GTGATGACGCCGTGGGCCGGGGACAACTGGGGCGGCGTGGTGCTGCCGCGCAAGGGCCAGGAAGTGCTGG
TGGGGTTCCTGGAAGGGGACATCGACCGGCCGGTGGTGATCGGCAGCGTGTACAACGGGCGCGGCCAGGA
CGAGGCGGCGCACAACCAGGTCGGCGGCGGCGGGGCCGGGGCCACCGGCAATGCGCCGGCGTGGTTCCAG
GGCAACGCGCACGGTGCGGTGTTCACCGGGTTCAAGAGCCAGGCGCTGGCGCAGAGCCAGGACGGCACCG
GCGGCTACCAGCAGCTGCGGCTGGACGACACGCCCGGCCAGGGCCGCGCGCAGCTGTCGACCACCCAGCA
CGCCAGCAGCTTGACCCTGGGCCACCTGAAGGGCGGCCACGACAACCTGCGCGAAGGCGAGCGCGGGTAC
GGGGCGGACCTGTCCACGCAGGCCTACGGCGCGGTGCGCGCCGGCCAGGGCCTGCTGCTGAGCAGCGAGC
CGGGCAACACCCAACTGGCCGCCACCGGCGCGCTGAGTCAACTGCAGCAGGGCAGCGACCTGCTCAAGCG
CCTCAACGACGCCGCCCGCACCCAGCAGGCGGGCCTACCGAGCGAACCGGAGTCCCTGCCGACCCAGGAC
GGCCTGAAGACCTTGCAGGACCACCTGCAGGCCACCCACACCGGCAGCGCGGCCGGCGAGATCGGCGGTG
GCGCCGGCGAGGTGCCCGGCTGGAGCGCCCCAGTGCTGCTGGGCAGCGGCCAGGCCGGCGTGATGAGCCT
GACCCCGGCCGATCAGGTGTGGGTGTCGGGCACCCAGACCGCGCTGCTGGCCGGCAGCGCACTGAACTGG
CTGAGCCAGGGCCACCTGGTGCTGGCGGTGGCCGGCGGGCTGGTGCTGTACACCCAGGGCGGCGACCCGG
TCGCCGGCAGCCCCAACCAGGAGCGCGGCATCGCCCTGCACGCCGCGCAAGGCACGCTCAGCGCCCGCGC
GCACAAGAACACCGCCACCCTGGCCGCCAAGACCCAGGTGCGCATCGTCAGCACCACCGCCGACGTCCAG
CTCACCGCGCCGACCAGGCACCTGCTGGCCACCGCGGCCGGCGCCTACATCAAGCTGGACGGCGACGACA
TCGAACTGGGCGCGCCGGGGGTGGTCGCGTTCAAGGGCGGGCAGCAGGTGTTGACGGCGCCGCAGGGGGC
ATCCATGAGCCCCGTGACGCCATCCGCCAGCCACAAGCTGTGTGAATACACCGCCCGCGCGGCAGATTTC
GCCGGTGCAGGGACGATGGGGGCCGCCTGA