SecReT6
Protein ID: 188577926
SecReT6 ID287
T6SS typei4b
Gene symbol-
Locus tagPXO_02053
StrainXanthomonas oryzae pv. oryzae PXO99A
Repliconchromosome [GenBank: NC_010717] [Browse all T6SS(s) in this replicon]
Location [Strand]3857577..3857786 [-]
ProductVGR-related protein
NoteTssI
UniProt IDB2SI81
KEGG IDxop:PXO_02053
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 69 a.a.     [Download]
>gi|188577926|ref|YP_001914855.1| unnamed protein product [Xanthomonas oryzae pv. oryzae PXO99A]
MDPVATVLSALSAAPHQQERLLRLHTPLGPDVLVAETLDGRESVDGGGFRFDVGALSANAGLPLDDLLG
 
Nucleotide Sequence: 210 bp     [Download]
>gi|188574270|ref|NC_010717.1|:c3857786-3857577 Xanthomonas oryzae pv. oryzae PXO99A chromosome, complete genome
ATGGACCCGGTCGCCACAGTACTTTCCGCCCTCAGCGCCGCCCCGCACCAGCAAGAACGCCTGCTGCGGT
TGCACACCCCGCTGGGCCCCGACGTGCTGGTCGCCGAGACCCTGGATGGCCGCGAGTCGGTCGACGGCGG
CGGCTTCCGTTTCGACGTGGGCGCACTATCGGCCAACGCCGGCCTGCCGCTGGACGACCTGCTCGGCTAG