SecReT6
Protein ID: 188577930
SecReT6 ID287
T6SS typei4b
Gene symbolevpF
Locus tagPXO_02049
StrainXanthomonas oryzae pv. oryzae PXO99A
Repliconchromosome [GenBank: NC_010717] [Browse all T6SS(s) in this replicon]
Location [Strand]3862156..3863991 [-]
ProductEvpF protein
NoteTssF
UniProt IDB2SI85
KEGG IDxop:PXO_02049
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.40E-206, Aligned region: 4..610
Protein Sequence: 611 a.a.     [Download]
>gi|188577930|ref|YP_001914859.1| evpF gene product [Xanthomonas oryzae pv. oryzae PXO99A]
MQDLLPYYERELGYLRRYGREFAERYPKIAGRLQLSADGSQDPHVERLIEAFALMGARISKRIEDDYPEF
TDALLEVLYPHYLRPFPSCSIAYFDMEGVAAKLSAPIRVPRGSYLLSRPVRGINCRFRTAYDVVLVPVAV
KAASYRGVAEAPMAVSLPPGTGAQISISFELLSDQASFAGLGTDALRFFVDGEPSFCSAMRDALALGVKA
AYVESDGSGRWRRLADTPLVPVGFADDESLIDFPARSHPAYRLLTELFGYPDKFGFFDLQLKPVTAGASR
WFTLHLVLQATPPDRAANQVLEELDCKNIRLGCTPVVNLFAQHGEPIRVTHRSVTYPVIADGRRAFAYEV
HSIDSVHRIRQTPQGELIQEFRPFYSLHHGEDPERAGQYWVARRDEDVARQSPGYETEVSFVDLEFNPTL
PQTDVVSVELTCSNRDLPSQLAYGIAGGDLSIEGGTPARAISLLRKPSRPLRFRHGRGAQWRLISHLSLN
QLSLTGSGLPALKEMLRLYDISGSSVSSRQIDGIVGIEQYPVTTWLSGKHFASVVRGLEVRLTISENHFV
GTGVAAFAHVLDHFFGLYVHANSFIRLVLISSDTGEELVRCLPRSGESILA
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|188574270|ref|NC_010717.1|:c3863991-3862156 Xanthomonas oryzae pv. oryzae PXO99A chromosome, complete genome
ATGCAAGACCTGCTTCCCTACTACGAACGCGAACTGGGCTATCTGCGTCGCTACGGGCGCGAGTTCGCCG
AGCGCTATCCCAAGATTGCCGGGCGCCTGCAGCTGTCGGCCGACGGCAGCCAGGATCCGCATGTCGAGCG
CCTGATCGAGGCGTTCGCGCTGATGGGCGCGCGCATCTCCAAGCGCATTGAGGACGACTACCCCGAGTTC
ACCGACGCGCTGCTGGAAGTGCTGTATCCGCACTATCTGCGGCCGTTTCCGTCCTGCTCCATCGCCTATT
TCGACATGGAAGGCGTGGCTGCCAAGCTCAGCGCGCCGATCCGCGTGCCGCGCGGCAGCTACTTGCTGTC
GCGCCCGGTGCGCGGGATCAATTGCCGGTTCCGCACCGCCTACGACGTGGTACTGGTGCCGGTGGCGGTG
AAGGCCGCCAGCTACCGCGGCGTGGCCGAAGCGCCGATGGCGGTCAGCCTGCCGCCGGGCACCGGCGCAC
AGATCTCGATCAGCTTCGAGCTGTTGTCCGACCAGGCCTCGTTCGCTGGCCTGGGCACCGACGCGCTGCG
TTTCTTCGTCGACGGCGAGCCGTCGTTCTGCTCGGCGATGCGCGATGCGCTGGCGCTGGGGGTCAAGGCG
GCCTATGTCGAGTCCGACGGCAGCGGACGCTGGCGCCGGCTGGCGGACACCCCGCTGGTGCCAGTGGGAT
TCGCCGACGACGAATCGCTGATCGATTTCCCGGCGCGTTCGCACCCGGCCTACCGCCTGCTGACCGAGCT
GTTCGGCTACCCGGACAAGTTCGGCTTCTTCGATCTTCAGCTCAAGCCGGTGACCGCCGGCGCCAGCCGC
TGGTTCACGTTGCACCTGGTCCTACAAGCGACGCCGCCCGATCGCGCCGCCAACCAAGTGCTCGAGGAGT
TGGATTGCAAGAACATCCGCCTGGGCTGCACCCCGGTGGTGAACCTGTTCGCGCAGCACGGCGAGCCGAT
CCGCGTCACCCATCGCAGCGTCACCTATCCGGTGATCGCCGACGGGCGCCGCGCCTTTGCCTACGAAGTG
CATTCGATCGATTCGGTACACCGTATCCGGCAGACTCCGCAGGGCGAGCTAATCCAGGAGTTCCGCCCGT
TCTATTCGCTGCACCATGGCGAAGACCCCGAGCGCGCCGGCCAGTATTGGGTGGCGCGGCGCGACGAGGA
TGTGGCGCGGCAGAGTCCCGGTTACGAAACCGAAGTGAGCTTCGTGGACCTGGAATTCAATCCGACCCTG
CCGCAGACCGATGTGGTCAGCGTCGAACTCACCTGCAGCAATCGCGATTTGCCCAGCCAGCTCGCCTACG
GCATCGCCGGCGGCGACCTGTCGATCGAGGGCGGAACGCCGGCGCGCGCGATCAGCCTGTTGCGCAAGCC
GAGCCGGCCACTGCGGTTCCGCCACGGACGCGGCGCGCAATGGCGGCTGATCTCGCACCTGTCGTTGAAT
CAGCTGTCGCTGACCGGCAGCGGCTTGCCGGCGTTGAAGGAGATGCTGCGGCTGTACGACATCTCCGGCA
GCAGCGTGTCGTCGCGGCAGATCGACGGCATCGTCGGCATCGAGCAGTATCCGGTCACCACCTGGCTGTC
CGGCAAGCATTTCGCATCGGTGGTGCGCGGCCTGGAAGTGCGTTTGACCATCAGCGAAAACCATTTCGTC
GGGACCGGCGTGGCCGCGTTCGCGCATGTGCTCGACCACTTCTTCGGCCTCTACGTCCACGCCAACAGCT
TTATCCGGCTGGTGCTCATTTCCAGCGACACAGGGGAGGAACTCGTCCGATGCTTACCGCGAAGCGGCGA
ATCGATCCTGGCGTAG