SecReT6
Protein ID: 188577931
SecReT6 ID287
T6SS typei4b
Gene symbol-
Locus tagPXO_02048
StrainXanthomonas oryzae pv. oryzae PXO99A
Repliconchromosome [GenBank: NC_010717] [Browse all T6SS(s) in this replicon]
Location [Strand]3863994..3864482 [-]
Producthypothetical protein
NoteTssE
UniProt IDB2SI86
KEGG IDxop:PXO_02048
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 6.90E-22, Aligned region: 31..138
Protein Sequence: 162 a.a.     [Download]
>gi|188577931|ref|YP_001914860.1| unnamed protein product [Xanthomonas oryzae pv. oryzae PXO99A]
MKGLEPSLLEKLFDDTPKSTGSSHVFKAISIDQYKESVARDLEGLLNTRSAFSEEGLTEFPNCKQSLLTY
GLGDFSAMSLANGYDRTMICRSLEQAIARHERRLRNVHVTLETAGQFGGGLHFTIHALLDMEPAREPVSF
DAMLQPSTLQYSVSRLRRQAAP
 
Nucleotide Sequence: 489 bp     [Download]
>gi|188574270|ref|NC_010717.1|:c3864482-3863994 Xanthomonas oryzae pv. oryzae PXO99A chromosome, complete genome
ATGAAGGGACTCGAACCCAGTCTGTTGGAAAAATTGTTCGACGACACGCCCAAGTCCACGGGTAGCTCGC
ATGTGTTCAAGGCCATCTCCATCGACCAATACAAGGAATCGGTCGCTCGCGACCTGGAAGGCCTATTGAA
CACCCGTTCGGCCTTCAGCGAAGAAGGCCTCACCGAATTTCCCAATTGCAAGCAGTCGTTGCTGACCTAC
GGCCTCGGCGATTTTTCCGCGATGAGCCTGGCCAATGGCTACGACCGCACGATGATCTGCCGCTCGCTGG
AGCAGGCGATCGCGCGCCATGAGCGGCGCCTGCGCAACGTGCACGTGACGCTGGAAACCGCCGGCCAGTT
CGGCGGCGGCCTGCATTTCACCATCCATGCGTTGCTGGACATGGAGCCGGCGCGCGAGCCGGTGAGCTTC
GACGCCATGCTGCAACCGTCCACCCTGCAGTACTCGGTCAGCCGCCTGCGGCGCCAGGCAGCGCCCTGA