SecReT6
Protein ID: 188577933
SecReT6 ID287
T6SS typei4b
Gene symbol-
Locus tagPXO_02047
StrainXanthomonas oryzae pv. oryzae PXO99A
Repliconchromosome [GenBank: NC_010717] [Browse all T6SS(s) in this replicon]
Location [Strand]3864630..3865127 [-]
ProductHcp family protein
NoteTssD
UniProt IDB2SI88
KEGG IDxop:PXO_02047
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-40, Aligned region: 5..138
Protein Sequence: 165 a.a.     [Download]
>gi|188577933|ref|YP_001914862.1| unnamed protein product [Xanthomonas oryzae pv. oryzae PXO99A]
MQHAFLSIDTIKGESHDDKHTDWVEIKSFSQDLLQPRSATASTAGGQSAARVNLSPIEIVKSIDLSTTAL
NQACANGTTFPKARIEFMRADKDGNAINYYLVELMNVLVHRVTTTVDEDGMPQEVVQLSFGAIKWTYNQQ
KPEGGVGGKAVAQWSATKNIPNYTV
 
Nucleotide Sequence: 498 bp     [Download]
>gi|188574270|ref|NC_010717.1|:c3865127-3864630 Xanthomonas oryzae pv. oryzae PXO99A chromosome, complete genome
ATGCAGCACGCGTTTCTTTCTATCGATACCATCAAGGGTGAATCGCACGACGACAAGCACACGGACTGGG
TGGAGATCAAGTCGTTCTCCCAGGACTTGTTGCAGCCGCGCTCGGCCACCGCATCCACCGCTGGCGGTCA
GTCGGCCGCTCGTGTAAACCTGTCGCCGATCGAGATCGTCAAGTCGATCGATCTGTCCACCACCGCGCTG
AATCAGGCGTGCGCCAACGGCACCACCTTCCCCAAAGCCCGCATCGAGTTCATGCGCGCCGACAAGGACG
GTAATGCCATCAACTACTACCTGGTTGAGTTGATGAACGTGCTGGTACACCGCGTCACCACGACGGTGGA
CGAGGACGGCATGCCGCAAGAAGTCGTCCAGCTGAGCTTCGGCGCGATCAAGTGGACCTACAACCAGCAG
AAGCCGGAAGGCGGAGTCGGCGGCAAGGCGGTTGCGCAGTGGAGTGCTACCAAGAACATTCCCAACTACA
CCGTTTGA