SecReT6
Protein ID: 188577934
SecReT6 ID287
T6SS typei4b
Gene symbolevpB
Locus tagPXO_02046
StrainXanthomonas oryzae pv. oryzae PXO99A
Repliconchromosome [GenBank: NC_010717] [Browse all T6SS(s) in this replicon]
Location [Strand]3865269..3866765 [-]
ProductEvpB protein
NoteTssC
UniProt IDB2SI89
KEGG IDxop:PXO_02046
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-194, Aligned region: 69..492
Protein Sequence: 498 a.a.     [Download]
>gi|188577934|ref|YP_001914863.1| evpB gene product [Xanthomonas oryzae pv. oryzae PXO99A]
MAAEVSSATHNSAPAALAETGLLDQIVEQSKVAKSETEHQRAKDIISELAKEVLEGTVVVSDNLNLTLDA
RIAEIDRIISEQLSAVMHAPEFQKLESSWRGLHYMCEQTSTGVTMKIKVFNSPQRDLVRDFKSAIDFDQS
ALFKKVYEEEFGTFGGAPFGALVGDYYIGRQPEDMYFVEQMSHVAAAAHAPFISAASESMFGLETFTDLG
KPRDLAKVFDTVEYAKWKSFRESEDSRYVGLTMPRFLGRLPYNPKDGTTVEGFNFVEDVDAADHSKYLWC
NTAYAMATRLTKAFEDYGWCAAIRGVEGGGLVEDLPTHTFRTDDGEVALKCPTEIAITDRREKELSDLGF
IPLVHCKNTDYAAFFGAQSAQKPKKYNTDAANANAILSAQLQYMFAVSRIAHYLKAMMREKIGSFASARN
VEDFLNRWISQYVLLDDNAGQEAKAQYPLREASVQVSEVPGKPGVYRAVAFIRPHFQLDELSVSLRLVAE
LPAGTKKA
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|188574270|ref|NC_010717.1|:c3866765-3865269 Xanthomonas oryzae pv. oryzae PXO99A chromosome, complete genome
ATGGCCGCAGAGGTTTCGAGTGCCACCCACAATTCGGCGCCCGCCGCGCTGGCAGAAACAGGCTTGCTCG
ACCAGATCGTCGAGCAGAGCAAGGTCGCCAAATCGGAGACCGAGCACCAGCGTGCGAAGGACATCATCTC
CGAGCTGGCCAAGGAGGTGCTGGAAGGTACCGTCGTGGTGTCGGACAACCTCAATCTGACGCTGGACGCG
CGCATTGCCGAGATCGATCGGATCATCTCTGAGCAGCTGAGCGCGGTGATGCATGCGCCGGAGTTCCAGA
AGCTGGAGAGCAGCTGGCGCGGCCTGCACTACATGTGCGAGCAGACGTCCACCGGCGTGACGATGAAGAT
CAAGGTCTTCAACTCGCCCCAACGGGATCTGGTGCGCGACTTCAAGTCGGCGATCGACTTCGATCAAAGC
GCGCTGTTCAAGAAGGTCTACGAGGAAGAGTTCGGCACCTTCGGCGGTGCGCCATTCGGCGCACTGGTCG
GCGACTACTACATCGGCCGCCAGCCGGAGGACATGTACTTCGTCGAGCAGATGTCGCATGTGGCCGCCGC
GGCGCACGCGCCCTTCATCTCTGCCGCGTCTGAATCGATGTTTGGTCTGGAAACCTTCACCGACCTGGGC
AAACCGCGCGATCTGGCCAAGGTGTTCGACACTGTCGAATACGCCAAGTGGAAGTCGTTCCGTGAGTCGG
AGGATAGCCGCTACGTCGGCCTGACCATGCCGCGTTTTCTCGGGCGGCTGCCGTACAACCCGAAGGACGG
CACTACGGTCGAAGGCTTCAACTTCGTCGAAGACGTCGACGCTGCCGACCATAGCAAGTATCTGTGGTGC
AACACCGCTTATGCGATGGCCACGCGCCTGACCAAGGCGTTCGAGGACTACGGTTGGTGCGCGGCGATCC
GCGGTGTGGAAGGCGGTGGCCTGGTCGAAGACCTGCCGACCCACACCTTCCGCACCGACGACGGCGAAGT
GGCGCTGAAGTGCCCGACCGAGATCGCGATCACCGACCGCCGCGAGAAGGAACTCAGCGACCTGGGCTTC
ATCCCGCTGGTACATTGCAAGAACACCGACTACGCGGCGTTCTTCGGTGCGCAGTCGGCGCAGAAGCCGA
AGAAGTACAACACCGATGCGGCCAATGCCAACGCGATCCTGTCGGCGCAGCTGCAGTACATGTTCGCCGT
GTCGCGTATCGCCCATTACCTCAAGGCGATGATGCGCGAGAAGATCGGCAGTTTCGCCTCGGCGCGTAAT
GTCGAGGACTTCCTGAACCGTTGGATCTCCCAGTACGTGTTGTTGGACGACAACGCCGGTCAGGAAGCAA
AGGCGCAATACCCCTTGCGGGAAGCGTCCGTACAAGTTTCGGAAGTGCCGGGGAAACCCGGTGTCTACCG
CGCGGTGGCCTTCATCAGGCCGCATTTCCAGCTCGATGAGCTGTCTGTTTCGTTGCGTCTGGTGGCCGAA
CTGCCGGCTGGTACCAAGAAGGCGTAG