SecReT6
Protein ID: 188577935
SecReT6 ID287
T6SS typei4b
Gene symbolevpA
Locus tagPXO_02045
StrainXanthomonas oryzae pv. oryzae PXO99A
Repliconchromosome [GenBank: NC_010717] [Browse all T6SS(s) in this replicon]
Location [Strand]3866769..3867269 [-]
ProductEvpA protein
NoteTssB
UniProt IDB2SI90
KEGG IDxop:PXO_02045
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.40E-58, Aligned region: 11..164
Protein Sequence: 166 a.a.     [Download]
>gi|188577935|ref|YP_001914864.1| evpA gene product [Xanthomonas oryzae pv. oryzae PXO99A]
MAKKESIQKRLQKIRPPRVQLTYDVEKGDAIEQKELPFVVGVLGDFSGNPEQPLAKVKDRKFVNVDLDNF
DEVMEGMAPRAVYRVPNKISDAGGEFRVELKFKSIDDFRPEAVVDQVEPLRKLLESRTKLADLRNKLAGN
EKLEDLLTDVLNNTEQLKKLGREKEK
 
Nucleotide Sequence: 501 bp     [Download]
>gi|188574270|ref|NC_010717.1|:c3867269-3866769 Xanthomonas oryzae pv. oryzae PXO99A chromosome, complete genome
ATGGCTAAGAAGGAAAGCATCCAGAAACGTCTGCAGAAGATTCGGCCGCCGCGCGTGCAGCTGACCTACG
ACGTGGAAAAGGGTGACGCGATCGAACAGAAGGAGCTGCCGTTCGTGGTAGGCGTGCTTGGGGATTTCAG
CGGCAATCCCGAACAGCCCCTGGCCAAGGTCAAGGACCGCAAATTCGTCAACGTCGACCTCGACAACTTC
GACGAGGTGATGGAGGGAATGGCGCCGCGCGCGGTTTACCGTGTGCCGAACAAGATCAGCGATGCCGGCG
GCGAGTTCCGCGTCGAACTCAAGTTCAAGTCGATCGACGACTTCCGTCCGGAGGCTGTGGTCGATCAGGT
CGAACCGCTGCGCAAGCTGCTGGAATCGCGCACCAAGCTGGCAGACCTGCGCAACAAGCTGGCCGGCAAC
GAGAAGCTCGAAGACCTGCTAACGGACGTGTTGAACAACACCGAACAGCTGAAGAAGCTGGGTCGGGAAA
AGGAGAAGTAA