SecReT6
Protein ID: 188577937
SecReT6 ID287
T6SS typei4b
Gene symbol-
Locus tagPXO_02043
StrainXanthomonas oryzae pv. oryzae PXO99A
Repliconchromosome [GenBank: NC_010717] [Browse all T6SS(s) in this replicon]
Location [Strand]3868191..3868799 [+]
Productlipoprotein
NoteTssJ
UniProt IDB2SI92
KEGG IDxop:PXO_02043
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.00E-31, Aligned region: 18..174
Protein Sequence: 202 a.a.     [Download]
>gi|188577937|ref|YP_001914866.1| unnamed protein product [Xanthomonas oryzae pv. oryzae PXO99A]
MNISAHRFNFLLVLIVAALALSGCASGGIGKAMDKTLQAVGIKEAKPEASPMIPLRLFAGSNLNAGSDTH
ATAAVVKIYHLRSAQRFEQAAFNAFLDQAGEQAALGADLLSVNEIVLTPSARQELNEQMSEGTTTLGVVG
LFRAPAEGRWRMAFDTRRKELPTQGITIGIHACALTTASPALVTRLAGDPSSLASVRCAAAR
 
Nucleotide Sequence: 609 bp     [Download]
>gi|188574270|ref|NC_010717.1|:3868191-3868799 Xanthomonas oryzae pv. oryzae PXO99A chromosome, complete genome
ATGAACATATCCGCCCACCGTTTCAATTTTCTGTTGGTTCTTATTGTAGCCGCCCTAGCCCTGTCAGGCT
GCGCCAGCGGCGGCATCGGCAAGGCGATGGACAAGACCCTGCAGGCAGTGGGCATCAAGGAAGCAAAGCC
AGAGGCGTCTCCGATGATTCCCCTGCGGCTGTTTGCCGGCAGCAACCTGAATGCGGGCAGCGACACGCAC
GCCACCGCAGCGGTGGTCAAGATCTATCACCTGCGCAGCGCGCAACGCTTCGAGCAGGCCGCGTTCAACG
CGTTCCTCGATCAGGCCGGAGAGCAGGCGGCGCTGGGCGCGGACCTGCTGTCGGTCAACGAGATCGTTCT
GACGCCAAGCGCCCGCCAGGAACTGAACGAGCAGATGTCCGAAGGCACCACCACCCTGGGCGTGGTGGGC
TTGTTCCGCGCGCCGGCCGAGGGCCGCTGGCGCATGGCCTTCGATACGCGACGCAAGGAATTGCCGACCC
AGGGCATCACCATCGGCATTCACGCCTGCGCGCTGACCACCGCCAGCCCGGCGCTGGTCACCCGCCTGGC
GGGCGATCCCAGCAGCCTGGCGTCGGTGCGTTGCGCCGCTGCGCGCTAG