SecReT6
Protein ID: 188577938
SecReT6 ID287
T6SS typei4b
Gene symbol-
Locus tagPXO_02042
StrainXanthomonas oryzae pv. oryzae PXO99A
Repliconchromosome [GenBank: NC_010717] [Browse all T6SS(s) in this replicon]
Location [Strand]3868984..3870285 [+]
Producthypothetical protein
NoteTssK
UniProt IDB2SI93
KEGG IDxop:PXO_02042
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.60E-138, Aligned region: 5..431
Protein Sequence: 433 a.a.     [Download]
>gi|188577938|ref|YP_001914867.1| unnamed protein product [Xanthomonas oryzae pv. oryzae PXO99A]
MRPQHFQRQDTYHEARLQDLAQTLHPYGWGTRRIRFDPQSMASGSLRALALSVVFPDGESYDAPAHDALP
DALSLNDLPAGIQTTTVYLALPLLRDDGGNCSDAEGSQLARYQQLNRPTSDLYTDAAQSELAYLSKAVKL
LTDDTPRDPYVTVPVARVRRTPTGGFELDEDFIPSCAHIDASPTLYRELRGLLDSLQAKVDALYGLHRQS
SQHIIEFRSGDIASFWLLHTACSSFGALSHLFHHPQLHPERLYQELLRMAGALLTFSNAYQLNDLPRYNH
AAPEACFQRLFQIVRDLLDTVISARYFKIALTEVKPSFHLGRIDSQRIDENAAFYLSVSADMPGPELVQT
VPVRFKIGAPDDVEKCVLSALPGVKLTHAAQVPAAIPVRPGSYYFALEARGPLYERMLKAQSMMLYVPSG
IDDLKMELVAVTS
 
Nucleotide Sequence: 1302 bp     [Download]
>gi|188574270|ref|NC_010717.1|:3868984-3870285 Xanthomonas oryzae pv. oryzae PXO99A chromosome, complete genome
TTGCGGCCGCAGCATTTCCAGCGCCAGGACACCTACCACGAAGCAAGGCTGCAGGATCTGGCGCAGACGC
TGCATCCCTATGGCTGGGGAACGCGCCGGATCCGTTTCGATCCGCAGAGCATGGCTAGCGGCAGCTTGCG
CGCGCTCGCCCTGTCGGTGGTCTTTCCCGATGGCGAATCGTACGACGCGCCGGCGCACGACGCGCTGCCC
GATGCGCTGTCGCTGAATGACCTCCCCGCCGGCATCCAGACCACCACGGTGTACCTGGCGCTGCCGTTGC
TGCGCGACGACGGCGGCAACTGTAGCGATGCGGAGGGTTCGCAACTGGCCCGCTACCAGCAGCTCAACCG
GCCGACCAGCGACCTGTACACCGACGCGGCCCAATCGGAACTGGCGTACCTGAGCAAGGCGGTGAAGCTG
CTCACCGACGACACTCCGCGCGATCCGTACGTGACCGTGCCGGTGGCGCGCGTGCGCCGTACCCCGACCG
GCGGCTTCGAGCTGGACGAGGACTTCATCCCGTCATGCGCACACATCGACGCCTCGCCGACGCTGTATCG
CGAACTGCGCGGCCTGCTCGACTCGCTGCAGGCCAAGGTCGACGCGCTGTACGGGCTGCATCGGCAATCG
TCGCAGCACATCATCGAATTCCGCTCCGGCGACATCGCCTCGTTCTGGCTGCTGCATACCGCCTGTTCCT
CGTTCGGCGCGCTGTCGCACCTGTTCCATCATCCGCAGCTGCACCCCGAGCGCCTGTACCAGGAACTGCT
GCGCATGGCCGGCGCGTTGCTGACGTTCTCCAACGCCTACCAGCTCAACGACCTGCCCCGGTACAACCAC
GCGGCGCCGGAAGCCTGCTTCCAGCGCCTGTTCCAGATCGTGCGCGACCTGCTCGACACGGTGATCTCGG
CGCGCTACTTCAAGATCGCGCTGACCGAGGTCAAGCCGTCGTTCCACCTGGGCCGGATCGATTCGCAGCG
GATCGACGAGAACGCCGCGTTCTACCTGAGCGTGTCGGCCGACATGCCCGGGCCGGAACTGGTGCAGACG
GTGCCGGTGCGGTTCAAGATCGGTGCGCCGGACGACGTCGAGAAGTGCGTGCTGTCGGCCCTGCCGGGCG
TGAAGCTGACCCACGCCGCGCAGGTGCCGGCAGCGATCCCGGTCCGTCCCGGCAGCTACTATTTCGCCCT
GGAAGCGCGCGGGCCGCTGTACGAGCGCATGCTCAAGGCGCAGTCTATGATGCTCTATGTGCCGTCAGGC
ATTGATGACCTCAAGATGGAACTTGTCGCGGTAACCTCATGA