SecReT6
Protein ID: 188577939
SecReT6 ID287
T6SS typei4b
Gene symbol-
Locus tagPXO_02041
StrainXanthomonas oryzae pv. oryzae PXO99A
Repliconchromosome [GenBank: NC_010717] [Browse all T6SS(s) in this replicon]
Location [Strand]3870285..3871073 [+]
Producthypothetical protein
NoteTssL
UniProt IDB2SI94
KEGG IDxop:PXO_02041
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.00E-57, Aligned region: 32..233
Protein Sequence: 262 a.a.     [Download]
>gi|188577939|ref|YP_001914868.1| unnamed protein product [Xanthomonas oryzae pv. oryzae PXO99A]
MNPLPPTPGPMPSLTAQAPHGLPSAHTSTPQSLLDLMADGFYLLLLLKRTQMPSDTESFVQSVQTFLDGV
ERGAVKLGIASEDIYAAKYAFCAAVDEAILSQPSALHETWERNPLQLRLFGEHLAGEHFFDRLEELRRQG
AVRLPSLEIYHYCLLLGFEGKYRLEGPEKLGYLTARLGDEIIYFKGKRSGFAPHWPPPDNVRHALRRVVP
LWLPAALVTGFGLLGFFGLRLSLDHQTERRMAAYNQVVQMPQRTAHITITLP
 
Nucleotide Sequence: 789 bp     [Download]
>gi|188574270|ref|NC_010717.1|:3870285-3871073 Xanthomonas oryzae pv. oryzae PXO99A chromosome, complete genome
ATGAACCCGCTGCCCCCCACCCCCGGCCCGATGCCGTCGCTGACCGCGCAGGCACCGCACGGCCTGCCGA
GCGCCCATACCTCCACGCCGCAGAGCCTGCTCGACCTGATGGCCGACGGCTTCTACCTGTTGCTGCTGCT
CAAGCGCACGCAGATGCCCAGCGACACCGAATCCTTCGTGCAGTCGGTGCAGACATTCCTCGATGGCGTG
GAACGCGGCGCAGTCAAGCTCGGCATCGCCTCCGAGGACATCTACGCGGCCAAATACGCGTTCTGCGCGG
CAGTAGACGAAGCGATCCTGTCGCAGCCCTCGGCACTGCACGAAACCTGGGAACGCAATCCGCTGCAGCT
GCGCCTGTTCGGCGAACACCTGGCCGGCGAGCATTTCTTCGATCGCCTGGAAGAGCTGCGCCGCCAGGGC
GCCGTGCGCCTGCCCTCGCTGGAGATCTACCACTATTGCCTGCTGCTTGGCTTCGAAGGCAAGTATCGGC
TGGAAGGGCCGGAAAAGCTCGGCTACCTGACCGCGCGGCTGGGCGACGAGATCATCTATTTCAAGGGCAA
GCGCAGCGGTTTCGCACCGCATTGGCCGCCGCCGGACAACGTGCGCCATGCCTTGCGCCGTGTGGTGCCG
CTGTGGCTGCCGGCCGCGCTGGTGACCGGCTTCGGCCTGCTCGGCTTCTTCGGTCTGCGCCTGTCTCTGG
ACCACCAGACCGAGCGGCGCATGGCCGCCTACAACCAGGTGGTGCAGATGCCGCAACGCACCGCGCACAT
TACGATCACCCTGCCGTGA