SecReT6
Protein ID: 188577940
SecReT6 ID287
T6SS typei4b
Gene symbol-
Locus tagPXO_02040
StrainXanthomonas oryzae pv. oryzae PXO99A
Repliconchromosome [GenBank: NC_010717] [Browse all T6SS(s) in this replicon]
Location [Strand]3871084..3873627 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDB2SI95
KEGG IDxop:PXO_02040
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.40E-57, Aligned region: 41..344
Phage_GPD [PF05954], Evalue: 9.40E-57, Aligned region: 620..774
DUF2345 [PF10106], Evalue: 3.50E-49, Aligned region: 230..281
DUF2345 [PF10106], Evalue: 3.50E-49, Aligned region: 582..615
DUF2345 [PF10106], Evalue: 3.50E-49, Aligned region: 669..823
T6SS_Vgr [PF13296], Evalue: 2.20E-30, Aligned region: 225..260
T6SS_Vgr [PF13296], Evalue: 2.20E-30, Aligned region: 517..623
T6SS_Vgr [PF13296], Evalue: 2.20E-30, Aligned region: 700..720
Phage_base_V [PF04717], Evalue: 2.20E-16, Aligned region: 388..497
Protein Sequence: 847 a.a.     [Download]
>gi|188577940|ref|YP_001914869.1| unnamed protein product [Xanthomonas oryzae pv. oryzae PXO99A]
MDIPTLAVALASLAQPSQHARLIQLRAPVEGLVVERFHGQEAVCGATVLQIACLATSAFLDAEALLEQPL
DLQLRQADGTQRHWQGLCTEVAQLGGDGGLARYRLTLAPWTALLELRRNALVFQDLDARAICERIFADYP
QAAFRFDVQAALPAHPITTQYRETDWAFVTRLLAEAGLAWRYAHAQDADSQATAATLVIFDPQAQVPDSG
TIRFHRSDLAEADDAIGAFGERRGVVPTASTVTSWHSEQVRAVGAQAQAQAEAGALPPLEVYVQPRAGRF
AQEATAQDQAQARLDALRVPHTLHAGAGSARVLAAGAAFTLRQHAQHDGQHFVPVAIEHVAVNNLGQGIV
ALLDAPELEHGSYRNRFLAVPAATPLRALPQDRPRMPGPQSARVVGVADAALSPSRDHQVRIQFPWQRGD
QPTPGGLTDSASTAPGHAPGDQRAGTWVPVAEWVAGPNWGSHFLPRIGSEVLVEFLHGDIDQPRITGQLY
NGELAPPFGGGLDAHASHPGTLSGLHTQSHDGSGTQQWLLDDTPGQLRTRLHTSLADTRLELGYLVQHSD
TARGALRGQGFELASQGWGNVHAAQGLLLSSSARGQGASTALDVAEAVAQLHGAQRTAQALHATLTQQQV
PGLDAHPSVTRLREAIDPQAQGKYTAAVGGQAATTPADGGRDGQAPVERFAQARLLGESPDHIAWTTPAS
AVAYAGQALQLTVQQDAQLSAGQTLSAVSGQHTALFAQRGPIKLIAAAGPVSLQAHTGALELLADQAVTV
TATDTRIDVLAQHKIVLQAGQTCITLEGGDITFACPGQFTVKASTHPFLGGESGNPQFALPDGLVHLEPD
RMLDFSG
 
Nucleotide Sequence: 2544 bp     [Download]
>gi|188574270|ref|NC_010717.1|:3871084-3873627 Xanthomonas oryzae pv. oryzae PXO99A chromosome, complete genome
ATGGATATCCCGACGCTGGCCGTCGCCCTGGCTAGTCTGGCGCAGCCGTCCCAACATGCCCGCCTGATCC
AACTGCGCGCCCCGGTCGAGGGGCTGGTGGTGGAACGCTTCCACGGGCAGGAGGCGGTGTGCGGCGCCAC
CGTGCTGCAGATCGCGTGCCTGGCCACCTCGGCGTTTCTCGATGCCGAGGCGCTGCTGGAGCAGCCACTG
GACCTGCAGCTGCGCCAGGCCGACGGCACGCAACGCCACTGGCAGGGCCTGTGCACCGAAGTGGCGCAAC
TGGGCGGCGACGGCGGCCTGGCCCGCTACCGGCTGACCCTGGCGCCGTGGACGGCGCTGCTGGAGCTGCG
GCGCAACGCGCTGGTGTTCCAGGACCTGGACGCGCGCGCGATCTGCGAACGGATCTTCGCCGACTACCCG
CAGGCCGCGTTCCGCTTCGACGTGCAGGCCGCGTTGCCGGCGCACCCGATCACCACCCAATACCGCGAGA
CCGACTGGGCCTTCGTCACCCGCCTGCTGGCCGAGGCCGGCCTGGCCTGGCGCTACGCGCACGCGCAGGA
CGCCGACAGCCAGGCCACCGCGGCCACGCTGGTGATCTTCGACCCGCAGGCGCAGGTGCCGGACAGCGGC
ACGATCCGCTTCCACCGCAGCGACCTGGCCGAGGCCGACGATGCGATCGGCGCCTTCGGCGAGCGCCGCG
GCGTCGTGCCCACCGCCAGCACGGTGACCAGCTGGCACAGCGAGCAAGTGCGCGCGGTCGGCGCGCAGGC
CCAGGCCCAGGCCGAGGCCGGCGCGCTGCCGCCGCTGGAGGTCTACGTGCAGCCGCGCGCCGGGCGTTTC
GCCCAGGAGGCGACCGCGCAGGATCAGGCGCAGGCGCGGCTGGACGCGCTGCGCGTGCCGCACACGCTGC
ACGCCGGGGCCGGCAGCGCCCGCGTGCTGGCGGCCGGGGCGGCGTTCACCTTGCGCCAGCACGCCCAGCA
CGACGGCCAGCATTTCGTTCCGGTGGCGATCGAGCACGTGGCGGTGAACAACCTGGGCCAGGGCATCGTC
GCCCTGCTGGACGCGCCGGAGCTGGAGCACGGCAGCTACCGCAACCGTTTCCTGGCGGTGCCGGCGGCCA
CGCCGCTGCGCGCGCTGCCGCAGGACCGCCCGCGCATGCCCGGGCCGCAGAGCGCGCGCGTGGTCGGCGT
GGCCGACGCGGCGCTGAGCCCGAGCCGCGACCACCAGGTGCGGATCCAGTTCCCGTGGCAGCGCGGCGAC
CAGCCCACCCCGGGCGGGTTGACCGACAGCGCCAGCACCGCGCCCGGCCACGCGCCGGGCGACCAGCGCG
CCGGCACCTGGGTGCCGGTGGCCGAGTGGGTGGCCGGCCCGAACTGGGGCAGCCACTTCCTGCCGCGCAT
CGGCAGCGAAGTGCTGGTGGAGTTCCTGCACGGGGACATCGATCAGCCGCGCATCACCGGCCAGTTGTAC
AACGGCGAGCTCGCCCCACCCTTCGGCGGCGGCCTGGACGCGCATGCCAGCCACCCCGGCACGCTCAGCG
GCCTGCACACCCAGTCCCACGACGGCAGCGGCACCCAGCAATGGCTGCTGGACGACACCCCCGGCCAGCT
GCGCACGCGCCTGCACACCTCGCTGGCCGACACCCGGCTGGAACTGGGCTACCTGGTCCAGCACAGCGAC
ACCGCCCGCGGCGCGCTGCGCGGCCAGGGCTTCGAACTGGCCTCCCAGGGCTGGGGCAACGTGCATGCCG
CGCAAGGCCTGCTGCTGTCCAGCAGCGCCCGCGGCCAGGGCGCCTCGACCGCATTGGACGTGGCCGAGGC
GGTGGCCCAGTTGCACGGCGCCCAACGCACCGCTCAGGCGCTGCACGCCACCCTGACCCAGCAACAGGTG
CCCGGCCTGGACGCCCATCCCAGCGTGACCCGGCTGCGCGAGGCCATCGACCCGCAAGCGCAGGGCAAGT
ACACCGCTGCGGTCGGCGGCCAGGCAGCGACCACGCCGGCCGACGGCGGCCGCGACGGCCAGGCACCGGT
GGAACGCTTCGCCCAGGCGCGCCTGCTCGGCGAGTCGCCGGACCACATCGCCTGGACCACCCCGGCCAGC
GCGGTGGCCTATGCCGGGCAGGCCCTGCAGTTGACCGTGCAGCAGGATGCGCAGCTGAGCGCCGGGCAGA
CCCTGTCGGCGGTGTCCGGCCAGCACACCGCGCTGTTCGCCCAACGCGGGCCGATCAAACTCATCGCCGC
CGCCGGCCCGGTGAGCCTGCAAGCACATACCGGCGCGCTGGAACTGCTGGCCGACCAGGCGGTGACCGTC
ACCGCCACCGACACCCGCATCGACGTGCTGGCGCAGCACAAGATCGTGCTGCAGGCCGGACAGACCTGCA
TCACCCTGGAAGGCGGCGACATCACCTTCGCCTGCCCGGGGCAGTTCACGGTCAAGGCCAGCACGCATCC
GTTCTTGGGTGGGGAGAGCGGCAACCCCCAATTCGCCTTGCCCGATGGGCTGGTGCATCTGGAACCAGAC
CGCATGCTCGATTTCTCGGGCTGA