SecReT6
Protein ID: 188577942
SecReT6 ID287
T6SS typei4b
Gene symbol-
Locus tagPXO_02038
StrainXanthomonas oryzae pv. oryzae PXO99A
Repliconchromosome [GenBank: NC_010717] [Browse all T6SS(s) in this replicon]
Location [Strand]3877381..3878814 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDB2SI97
KEGG IDxop:PXO_02038
PDB IDNA
Domain hit(s) vs Pfam DUF2345 [PF10106], Evalue: 2.10E-49, Aligned region: 213..246
DUF2345 [PF10106], Evalue: 2.10E-49, Aligned region: 300..454
T6SS_Vgr [PF13296], Evalue: 9.10E-31, Aligned region: 148..254
T6SS_Vgr [PF13296], Evalue: 9.10E-31, Aligned region: 330..351
Phage_base_V [PF04717], Evalue: 1.50E-16, Aligned region: 19..128
Protein Sequence: 477 a.a.     [Download]
>gi|188577942|ref|YP_001914871.1| unnamed protein product [Xanthomonas oryzae pv. oryzae PXO99A]
MPAATPLRALPQDRSRMPGPQSARVVGVADAALSPSRDHQVRIQFPWQRGDQPTPGGLTDSASTAPGHAP
GDQRAGTWVPVAEWVAGPNWGSHFLPRIGSEVLVEFLHGDIDQPRITGQLYNGEVAPPFGGGLDARASHP
GTLSGLHTQSHDGSGTQQWLLDDTPGQLRTRLHTSLADTRLELGYLVQHSDTARGALRGQGFELASQGWG
NVHAAQGLLLSSSARGQGASTALDVAEAVAQLHGAQRTAQALHATLTQQQVPGLDAHPSVTQLREAIDPQ
AQGKYTAAVGGQAATKPADGGRDGQAPVERFAQARLLGESPDHIAWTTPASAVAYAGQALQLTVQQDAQL
SAGQTLSAVSGQHTALFAQRGPIKLIAAAGPVSLQAHTGALELLADQAVTVTATDTRIDVLAQHKIVLQA
GQTRITLEGGDITFACPGQFTVKASMHPFLGGESGSAALPPLPDSLKKPDGTAPFSV
 
Nucleotide Sequence: 1434 bp     [Download]
>gi|188574270|ref|NC_010717.1|:3877381-3878814 Xanthomonas oryzae pv. oryzae PXO99A chromosome, complete genome
GTGCCGGCGGCCACGCCCTTGCGCGCGCTGCCGCAGGACCGCTCGCGCATGCCCGGGCCGCAGAGCGCGC
GCGTGGTCGGCGTGGCCGACGCGGCGCTGAGCCCGAGCCGCGACCACCAGGTGCGGATCCAGTTCCCGTG
GCAGCGCGGCGACCAGCCCACCCCGGGCGGGTTGACCGACAGCGCCAGCACCGCGCCCGGCCACGCGCCG
GGCGACCAGCGCGCCGGCACCTGGGTGCCGGTGGCCGAGTGGGTGGCCGGCCCGAACTGGGGCAGCCACT
TCCTGCCGCGCATCGGCAGCGAAGTGCTGGTGGAGTTCCTGCACGGAGACATCGATCAGCCGCGCATCAC
CGGCCAGTTGTACAACGGCGAGGTCGCCCCACCCTTCGGCGGCGGCCTGGACGCGCGTGCCAGCCACCCC
GGCACGCTCAGCGGCCTGCACACCCAGTCCCACGACGGCAGCGGCACCCAGCAATGGCTGCTGGACGACA
CCCCCGGCCAGCTGCGCACGCGCCTGCACACCTCGCTGGCCGACACCCGGCTGGAACTGGGCTACCTGGT
CCAGCACAGCGACACCGCCCGCGGCGCGCTGCGCGGCCAGGGCTTCGAACTGGCCTCCCAGGGCTGGGGC
AACGTGCATGCCGCGCAAGGCCTGCTGCTGTCCAGCAGCGCCCGCGGCCAGGGCGCCTCGACCGCATTGG
ACGTGGCCGAGGCGGTGGCCCAGTTGCACGGCGCCCAACGCACCGCCCAGGCGCTGCACGCCACCCTGAC
CCAGCAACAGGTGCCCGGCCTGGACGCCCATCCCAGCGTGACCCAACTGCGCGAGGCCATCGACCCGCAG
GCGCAGGGCAAGTACACCGCTGCGGTCGGCGGCCAGGCGGCGACCAAGCCGGCCGACGGCGGCCGCGACG
GCCAGGCACCGGTGGAACGCTTCGCCCAGGCGCGCCTGCTCGGCGAGTCGCCGGACCACATCGCCTGGAC
CACCCCGGCCAGCGCGGTGGCCTATGCCGGGCAGGCCCTGCAGTTGACCGTGCAGCAGGATGCGCAGCTG
AGCGCCGGGCAGACCCTGTCGGCGGTGTCCGGCCAGCACACCGCGCTGTTCGCCCAACGCGGGCCGATCA
AACTCATCGCCGCCGCCGGCCCGGTGAGCCTGCAGGCACATACCGGCGCGCTGGAACTGCTGGCCGACCA
GGCGGTGACCGTCACCGCCACCGACACCCGCATCGACGTGCTGGCGCAGCACAAGATCGTGCTGCAGGCC
GGACAGACCCGCATCACCCTGGAAGGCGGCGACATCACCTTCGCCTGCCCGGGGCAGTTCACGGTCAAGG
CCAGCATGCATCCGTTCTTGGGTGGGGAGAGCGGCAGTGCCGCCCTGCCGCCTTTGCCTGACAGCTTGAA
GAAGCCCGATGGCACTGCACCTTTCTCCGTCTAA