SecReT6
Protein ID: 188577944
SecReT6 ID287
T6SS typei4b
Gene symbol-
Locus tagPXO_02036
StrainXanthomonas oryzae pv. oryzae PXO99A
Repliconchromosome [GenBank: NC_010717] [Browse all T6SS(s) in this replicon]
Location [Strand]3881635..3883398 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDB2SIW4
KEGG IDxop:PXO_02036
PDB IDNA
Domain hit(s) vs Pfam T6SS_Vgr [PF13296], Evalue: 1.30E-30, Aligned region: 32..69
T6SS_Vgr [PF13296], Evalue: 1.30E-30, Aligned region: 325..431
T6SS_Vgr [PF13296], Evalue: 1.30E-30, Aligned region: 508..528
DUF2345 [PF10106], Evalue: 2.70E-30, Aligned region: 37..89
DUF2345 [PF10106], Evalue: 2.70E-30, Aligned region: 390..424
DUF2345 [PF10106], Evalue: 2.70E-30, Aligned region: 477..585
Phage_GPD [PF05954], Evalue: 9.30E-17, Aligned region: 4..152
Phage_GPD [PF05954], Evalue: 9.30E-17, Aligned region: 428..581
Phage_base_V [PF04717], Evalue: 2.30E-16, Aligned region: 196..305
Protein Sequence: 587 a.a.     [Download]
>gi|188577944|ref|YP_001914873.1| unnamed protein product [Xanthomonas oryzae pv. oryzae PXO99A]
MSATLVIFDPQAQVPDSGTIRFHRSDLAEADDAIGAFGERRGVVPTASTVTSWHSEQVRAVGAQAQAQAE
AGALPPLEVYVQPRAGRFAQEATAQDQAQARLDALRVPHTLHAGAGSARVLAAGAAFTLRQHAQHDGQRF
VPVAIEHVAVNNLGQGIVALLDAPELEHGSYRNRFLAVPAATPLRALPQDRPRMPGPQSARVVGVADAAL
SPSRDHQVRIQFPWQRGDQPAPGGLTDSASTAPGHAPGDQRAGTWVPVAEWVAGPNWGSHFLPRIGSEVL
VEFLHGDIDQPRITGQLYNGEVAPPFGGGLDARASHPGTLSGLHTQSHDGSGTQQWLLDDTPGQLRTRLH
TSLADTRLELGYLVQHSDTARGALRGQGFELASQGWGNVHAAQGLLLSSSARDQGASTALDAAEAVAQLH
GAQRTAQALHATLTQQQVPGLDAHPSVTRLREAIDPQAQGKYTAAVGGQAATTPADGGRDGQAPVERFAQ
ARLLGESPDHIAWTTPASAVAYAGQALQLTVQQDAQLSAGQTLSAVSGQHTALFAQRGPIKLIAAAGPVS
LQAHTGALELLADQAVTVTATDTRASC
 
Nucleotide Sequence: 1764 bp     [Download]
>gi|188574270|ref|NC_010717.1|:3881635-3883398 Xanthomonas oryzae pv. oryzae PXO99A chromosome, complete genome
GTGTCGGCCACGCTGGTGATCTTCGACCCGCAGGCGCAGGTGCCGGACAGCGGCACGATCCGCTTCCACC
GCAGCGACCTGGCCGAGGCCGACGATGCGATCGGCGCCTTCGGCGAGCGCCGCGGCGTCGTGCCCACCGC
CAGCACGGTGACCAGCTGGCACAGCGAGCAAGTGCGCGCGGTCGGCGCGCAGGCCCAGGCCCAGGCCGAG
GCCGGCGCGCTGCCGCCGCTGGAGGTCTACGTGCAGCCGCGCGCCGGGCGTTTCGCCCAGGAGGCGACCG
CGCAGGATCAGGCGCAGGCGCGGCTGGACGCGCTGCGCGTGCCGCACACGCTGCACGCCGGGGCCGGCAG
CGCCCGCGTGCTGGCGGCCGGGGCGGCGTTCACCTTGCGCCAGCACGCCCAGCACGACGGCCAGCGTTTC
GTTCCGGTGGCGATCGAGCACGTGGCGGTGAACAACCTGGGCCAGGGCATCGTCGCCCTGCTGGACGCGC
CGGAGCTGGAGCACGGCAGCTACCGCAACCGCTTCCTGGCGGTGCCGGCGGCCACGCCGCTGCGCGCGCT
GCCGCAGGACCGCCCGCGCATGCCCGGGCCGCAGAGCGCGCGCGTGGTCGGCGTGGCCGACGCGGCGCTG
AGCCCGAGCCGCGACCACCAGGTGCGGATCCAGTTCCCGTGGCAGCGCGGCGACCAGCCCGCCCCGGGCG
GGTTGACCGACAGCGCCAGCACCGCGCCCGGCCACGCGCCGGGCGACCAGCGCGCCGGCACCTGGGTGCC
GGTGGCCGAGTGGGTGGCCGGCCCGAACTGGGGCAGCCACTTCCTGCCGCGCATCGGCAGCGAAGTGCTG
GTGGAGTTCCTGCACGGGGACATCGATCAGCCGCGCATCACCGGCCAGTTGTACAACGGCGAGGTCGCCC
CACCCTTCGGCGGCGGCCTGGACGCGCGTGCCAGCCACCCCGGCACGCTCAGCGGCCTGCACACCCAGTC
CCACGACGGCAGCGGCACCCAGCAATGGCTGCTGGACGACACCCCCGGCCAGCTGCGCACGCGCCTGCAC
ACCTCGCTGGCCGACACCCGGCTGGAACTGGGCTACCTGGTCCAGCACAGCGACACCGCCCGCGGCGCGC
TGCGCGGCCAGGGCTTCGAACTGGCCTCCCAGGGCTGGGGCAACGTGCATGCCGCGCAAGGCCTGCTGCT
GTCCAGCAGCGCCCGCGACCAGGGGGCCTCGACCGCATTGGACGCGGCCGAGGCGGTGGCCCAGTTGCAC
GGCGCCCAACGCACCGCTCAGGCGCTGCACGCCACCCTGACCCAGCAACAGGTGCCCGGCCTGGACGCCC
ATCCCAGCGTGACCCGGCTGCGCGAGGCCATCGACCCGCAAGCGCAGGGCAAGTACACCGCTGCGGTCGG
CGGCCAGGCAGCGACCACGCCGGCCGACGGCGGCCGCGACGGCCAGGCACCGGTGGAACGCTTCGCCCAG
GCGCGCCTGCTCGGCGAGTCGCCGGACCACATCGCCTGGACCACCCCGGCCAGCGCGGTGGCCTATGCCG
GGCAGGCCCTGCAGTTGACCGTGCAGCAGGATGCGCAGCTGAGCGCCGGGCAGACCCTGTCGGCGGTGTC
CGGCCAGCACACCGCGCTGTTCGCCCAACGCGGGCCGATCAAACTCATCGCCGCCGCCGGCCCGGTGAGC
CTGCAGGCACATACCGGCGCGCTGGAACTGCTGGCCGACCAGGCGGTGACCGTCACCGCCACCGACACCC
GCGCTAGCTGTTGA