SecReT6
Protein ID: 188577951
SecReT6 ID287
T6SS typei4b
Gene symbol-
Locus tagPXO_02029
StrainXanthomonas oryzae pv. oryzae PXO99A
Repliconchromosome [GenBank: NC_010717] [Browse all T6SS(s) in this replicon]
Location [Strand]3889002..3891788 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDB2SIX1
KEGG IDxop:PXO_02029
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.90E-62, Aligned region: 28..342
DUF2345 [PF10106], Evalue: 7.50E-36, Aligned region: 735..894
T6SS_Vgr [PF13296], Evalue: 9.00E-35, Aligned region: 571..677
Phage_base_V [PF04717], Evalue: 1.10E-24, Aligned region: 414..511
Protein Sequence: 928 a.a.     [Download]
>gi|188577951|ref|YP_001914880.1| unnamed protein product [Xanthomonas oryzae pv. oryzae PXO99A]
MLSDSGRLYRLQLPGGDVQVVERWSGSERLSGGFEWWVDVLSTQAGLPLEAWLGRRATLYTRLADGDESP
RTGLIHDAYVLGSDGGLARYRVGLVPWTWWLSQGRHSRVFQERTLVQIVEAVCADYAPMASWQWSEETSA
FLAQARPRSYCVQYRESDLDFVQRLLAEEGLGWRLQEADASPGGHQLVVFADSAAQPQDPSSAQGGGLRY
HRSDATEAADSVLAIGATRRLGSGRLTVLSEDFKTRQARSAQLPLHGGGRQSLREVYEPVGMDAFASAQA
ADRSAELMAQAHEAQWSPWQGRSTVRTLRAGTWFTLTQAPQQGQAPPAQLLLTRVWHAGINNLPVDVRAA
VQSQLGAAPAWPDASAVAARSTWAQAEAVGYGNAFEAVDRQQPWRPVLADGTGARLHPRPTAPGYQSAIV
VGADGSTDGSQEVHADALGRIRVRFHFQHAASAPAAQDSTWLRVAQRYAGPGVGSQFLPRIGQEVLVGFL
EGDIDRPVVLGALYNGKGEAGVPATPGGTSAEADTGLYAQAGDGRPSAQGNLAGGHAPAWHGAGGGADNH
RNATALWGVQSKEWGGAGHSRLVFDDSDQQLRLQLATTQAATQLNLGHLIHQADNYRGSFRGEGFELRTD
AWGAVRASSGLWLSSYGRSGGPAGEATQPSALLSQLQTLGKTFSQAAGTHQTVKLAAHEGVGQANHSQLI
AEQAPLPALLTSVKTTVPGTAYADAKGAAAERSASPGDDRVPHTGDALLGLAAPAGIGVVAGQGLSWSVG
ETLTLASGAGSEAAIAGDARLHSGQAIGVLAAAVDGGQTQANSLSLVSGEGALDVQAQSDEVRVQSKEGL
KLISANADVALAAGKTLHLAVAGGASVTIEAGNITVACPGTITVHASKKSFVGPVQQAYPLPAFAKSVCI
PCLLQAMGKGQALSPVNG
 
Nucleotide Sequence: 2787 bp     [Download]
>gi|188574270|ref|NC_010717.1|:c3891788-3889002 Xanthomonas oryzae pv. oryzae PXO99A chromosome, complete genome
TTGCTGTCCGACAGCGGCCGCCTATACCGCTTGCAGCTGCCTGGCGGGGATGTCCAGGTGGTGGAGCGCT
GGAGCGGGTCGGAACGGCTGAGCGGCGGTTTTGAGTGGTGGGTGGACGTGCTGAGCACGCAGGCGGGCTT
GCCGCTGGAGGCGTGGCTGGGGCGGCGCGCGACGCTGTACACCCGGCTGGCCGATGGCGATGAAAGCCCG
CGCACGGGGTTGATCCACGACGCGTACGTACTGGGCAGCGATGGCGGGCTGGCGCGCTACCGGGTAGGCC
TGGTGCCGTGGACGTGGTGGTTGTCGCAGGGCCGGCACAGCCGGGTATTCCAGGAACGCACGCTGGTGCA
GATCGTGGAAGCGGTGTGCGCCGACTACGCGCCGATGGCAAGCTGGCAGTGGAGCGAGGAGACGAGCGCG
TTCCTGGCCCAGGCGCGGCCGCGCAGCTACTGCGTGCAGTACCGCGAGAGCGACCTGGATTTCGTGCAGC
GGCTGCTGGCCGAGGAAGGCCTGGGCTGGCGGCTGCAGGAGGCGGACGCGTCGCCCGGCGGGCACCAGCT
GGTGGTGTTCGCCGACAGCGCCGCGCAACCGCAGGACCCCAGTTCGGCGCAGGGCGGGGGGCTGCGCTAC
CACCGCAGCGACGCCACCGAGGCGGCCGACAGCGTGCTGGCGATCGGCGCCACCCGGCGGCTGGGCAGCG
GCCGGCTGACGGTGCTCAGCGAGGACTTCAAGACGCGCCAGGCGCGCAGCGCGCAGTTGCCGTTGCACGG
CGGCGGCAGGCAGTCGCTGCGCGAGGTGTACGAGCCGGTGGGGATGGATGCCTTCGCCAGCGCGCAGGCA
GCAGACCGCTCTGCGGAGTTGATGGCGCAGGCGCACGAGGCGCAGTGGTCACCGTGGCAGGGCCGCAGCA
CGGTGCGCACGCTGCGCGCCGGCACCTGGTTCACGCTGACCCAGGCACCGCAGCAGGGCCAGGCGCCGCC
GGCGCAGCTGTTGCTGACGCGGGTGTGGCATGCGGGTATCAACAACTTGCCGGTGGACGTGCGCGCGGCG
GTGCAGTCGCAGTTGGGGGCCGCGCCGGCGTGGCCGGACGCCAGCGCGGTGGCCGCACGCAGCACCTGGG
CGCAGGCCGAGGCGGTGGGCTACGGCAACGCCTTCGAGGCGGTGGACCGGCAGCAGCCGTGGCGGCCGGT
CCTGGCCGACGGCACCGGGGCGCGGCTGCACCCGCGGCCGACCGCGCCGGGCTACCAGAGCGCCATCGTG
GTCGGTGCCGATGGCAGCACCGACGGCAGCCAGGAGGTCCATGCCGACGCGCTGGGCCGGATCCGGGTCA
GGTTTCACTTCCAGCACGCCGCGTCGGCCCCGGCCGCGCAGGACAGCACGTGGCTGCGGGTGGCGCAGCG
CTACGCCGGCCCGGGCGTGGGCAGCCAGTTCCTGCCGCGCATCGGCCAGGAAGTGCTGGTGGGCTTCCTG
GAGGGGGACATCGACCGTCCGGTGGTGCTGGGGGCGCTGTACAACGGCAAGGGCGAAGCCGGCGTTCCTG
CCACCCCCGGCGGCACCAGCGCCGAGGCCGACACCGGCCTGTACGCCCAGGCCGGCGACGGCAGACCCAG
CGCGCAGGGCAACCTGGCCGGCGGCCATGCCCCGGCCTGGCACGGCGCCGGCGGCGGCGCGGACAACCAC
CGCAACGCCACCGCGCTGTGGGGCGTGCAATCCAAGGAATGGGGCGGCGCTGGCCACAGCCGGCTGGTGT
TCGACGACAGCGACCAGCAACTGCGCTTGCAACTTGCGACCACCCAGGCAGCCACGCAACTGAACCTGGG
GCACCTGATCCACCAGGCCGACAACTACCGCGGCAGCTTCCGCGGGGAAGGCTTCGAACTGCGCACCGAC
GCGTGGGGCGCGGTGCGTGCCAGCTCGGGGCTATGGCTGAGCAGCTACGGCCGCAGCGGCGGCCCGGCCG
GCGAGGCGACCCAGCCCAGCGCATTGCTGAGCCAGCTGCAGACGCTGGGCAAGACGTTCTCGCAGGCGGC
GGGCACGCACCAGACGGTGAAGCTGGCCGCGCACGAAGGCGTGGGCCAGGCGAACCACTCCCAGCTGATC
GCCGAGCAGGCGCCGCTGCCGGCGCTGCTGACCAGCGTGAAGACCACGGTGCCGGGCACGGCCTACGCCG
ACGCCAAGGGCGCGGCGGCCGAGCGCAGCGCCAGCCCGGGCGATGACCGGGTGCCGCACACCGGCGATGC
GCTGCTGGGCCTGGCCGCACCAGCGGGGATCGGCGTGGTGGCCGGCCAGGGCCTGAGCTGGAGCGTGGGC
GAGACGCTGACGCTGGCCAGCGGCGCGGGCAGCGAAGCGGCCATCGCCGGCGACGCCCGGCTGCACAGCG
GCCAGGCAATCGGCGTGCTGGCCGCGGCGGTGGACGGCGGGCAAACGCAAGCCAACAGCCTGAGCCTCGT
CAGCGGCGAAGGCGCGCTGGACGTGCAGGCGCAGTCGGACGAAGTACGGGTGCAGTCGAAAGAAGGACTG
AAGCTGATCAGCGCCAACGCCGACGTGGCACTGGCGGCGGGCAAGACCCTCCACCTGGCGGTGGCCGGCG
GGGCCAGCGTGACCATCGAAGCCGGCAACATCACCGTCGCCTGCCCCGGCACCATCACCGTGCATGCGAG
CAAGAAGTCGTTTGTGGGGCCGGTGCAGCAGGCGTATCCGTTGCCCGCGTTCGCAAAGTCGGTCTGCATC
CCGTGCCTGTTGCAGGCCATGGGCAAGGGGCAAGCGTTGTCCCCGGTGAATGGGTGA