SecReT6
Protein ID: 189353338
SecReT6 ID289
T6SS typei3
Gene symbol-
Locus tagBMULJ_04578
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome II [GenBank: NC_010805] [Browse all T6SS(s) in this replicon]
Location [Strand]1578848..1580065 [-]
ProductOmpA/MotB family outer membrane protein
NoteTssL
UniProt IDA9AQ83
KEGG IDbmu:Bmul_3923, bmj:BMULJ_04578
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.10E-49, Aligned region: 32..245
OmpA [PF00691], Evalue: 4.70E-12, Aligned region: 314..397
Protein Sequence: 405 a.a.     [Download]
>gi|189353338|ref|YP_001948965.1| OmpA/MotB family outer membrane protein [Burkholderia multivorans ATCC 17616]
MSLITADPQSHGGSLASPSVATRLKRAEQSVNPLLEAARVLLSALADTPDVLDADSIARRRRWLEHELRL
FARLGAELGLSPEHIRSASYCLCSALDESAMQTRWGKGEATGVAWEVDGLAAAMGHDRQAGDRVFQLIDE
ALCSPREDLDLIELYQNILDLGFRGRYRFERDGQQRLTRVRERVHDVVVTGGVGANFARESLRQRRRTVD
PWVRPLARRRSSRVGAVVAITAALLLGAAGYAAVDRWVVSREAQRLSPFDALARNLERRLRDEVAAGNVE
LIRDPARHVLTLRFAGMFVPGAVTVAPWGASVVASAGREIASIAEGMVVRVVGYADSAPAGSARQVSNQA
LSEARAEDVARILVAAGVPAHGLRVEGRGDADALADNGTESGRARNRRVEVIVAE
 
Nucleotide Sequence: 1218 bp     [Download]
>gi|189351978|ref|NC_010805.1|:c1580065-1578848 Burkholderia multivorans ATCC 17616 chromosome 2, complete genome
ATGAGTCTGATAACAGCCGATCCGCAAAGCCACGGCGGGAGCCTGGCGTCGCCGTCCGTCGCGACGAGGC
TCAAGCGGGCGGAGCAGTCGGTCAACCCGCTGCTCGAAGCGGCGCGCGTCCTGTTGAGCGCGTTGGCAGA
TACGCCCGATGTGCTCGATGCCGATTCGATAGCCCGGCGGCGACGGTGGCTCGAGCATGAACTCCGGCTA
TTTGCGCGGCTCGGCGCTGAACTCGGGCTTTCGCCGGAGCATATCCGGAGCGCCAGCTACTGCCTGTGTT
CGGCGCTCGACGAGTCTGCGATGCAGACGCGCTGGGGCAAAGGAGAGGCAACCGGTGTCGCATGGGAAGT
CGATGGGCTCGCCGCGGCGATGGGTCACGACCGTCAGGCCGGCGACCGCGTTTTCCAGCTGATCGACGAG
GCGTTATGCAGCCCGCGCGAGGACCTTGATCTGATCGAGCTGTACCAGAACATCCTCGATCTCGGCTTTC
GCGGGCGTTATCGATTCGAGCGCGACGGACAGCAGCGCTTGACGCGCGTTCGCGAGCGCGTGCACGACGT
GGTCGTGACGGGCGGGGTGGGCGCGAATTTCGCAAGGGAGTCGCTTCGACAAAGGCGGCGCACGGTCGAC
CCTTGGGTGCGTCCATTGGCGAGGCGGCGATCGTCGCGCGTCGGGGCTGTCGTCGCCATAACCGCGGCGT
TGCTGCTCGGAGCCGCCGGATATGCCGCTGTGGACCGTTGGGTCGTGTCGAGAGAGGCGCAACGCCTGTC
GCCGTTCGACGCGCTGGCTCGCAATCTGGAACGGCGGCTCCGTGACGAGGTCGCAGCAGGGAATGTCGAA
CTGATCCGGGATCCCGCACGCCATGTCTTGACGCTCCGCTTTGCCGGCATGTTCGTACCGGGCGCGGTAA
CGGTGGCGCCTTGGGGTGCTTCCGTCGTGGCGTCGGCTGGCCGGGAAATTGCGTCGATCGCTGAAGGTAT
GGTCGTCAGGGTAGTGGGATACGCGGACAGCGCGCCGGCCGGGTCCGCGCGTCAGGTCTCCAATCAGGCA
CTTTCCGAAGCACGTGCCGAAGATGTCGCCCGGATTCTTGTCGCGGCCGGCGTACCGGCGCATGGCCTCC
GCGTGGAAGGGCGCGGGGATGCAGACGCGTTGGCGGACAACGGTACCGAGTCGGGAAGGGCGAGGAATCG
GCGCGTCGAAGTGATCGTCGCGGAATAA