SecReT6
Protein ID: 189353347
SecReT6 ID289
T6SS typei3
Gene symbol-
Locus tagBMULJ_04587
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome II [GenBank: NC_010805] [Browse all T6SS(s) in this replicon]
Location [Strand]1592216..1594753 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA9AQ74
KEGG IDbmu:Bmul_3914, bmj:BMULJ_04587
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.80E-72, Aligned region: 35..379
DUF2345 [PF10106], Evalue: 1.20E-49, Aligned region: 663..814
T6SS_Vgr [PF13296], Evalue: 1.40E-34, Aligned region: 524..633
Phage_base_V [PF04717], Evalue: 7.30E-18, Aligned region: 69..95
Phage_base_V [PF04717], Evalue: 7.30E-18, Aligned region: 262..310
Phage_base_V [PF04717], Evalue: 7.30E-18, Aligned region: 432..512
Protein Sequence: 845 a.a.     [Download]
>gi|189353347|ref|YP_001948974.1| Rhs element Vgr protein [Burkholderia multivorans ATCC 17616]
MALFDASRTLSVSGAALPTYGGQSLLTPVKLTGAETIGELFEYVLELKTPDALAFSPSIAANVDLDALIG
TEVTVSIQLEGRGHFIPGLAGGAGMGNIGAGMREITGIVSQATIVREDGRSIVYALTLRPWLWHATKNCD
CRIFQDMSVVEITDAVLSIYPFPVDKRLTTPRPNKVWPKRDIQRQHFESDWAFLQRLWEEWGIYYFFEHG
EGKHRLVLCDSMGALRPLGDAYAELRYEPPTSRRIDEEHIHEFSVSHALTTGAVTAVDYDYTLPRANLTV
TREDPRDTGLAHQERYSWGDYAQPQAGAAGLSGAHNEPRTEAEYLTLVQMQAWRCQGLTAQGKGNLRGMV
AGQTFVLSHYPQEAANREYAVIACRLMIEEIGEASGAGQQYRCEADFTVQPTNEPFRLLRTIAKPRMNGI
EYAVVTCPDNQEIWTDAYGRVKLQFLWDRLGKNDERSSCWVRVAGAWHGDQFGGVFLPRRGQEVEVAFVN
GDPDLPIVVGSAANAFNMPPFALPANQALAGYRSKEIGGRRANTLAFDDTNGKIQAHLSSDEGCSQLNLG
YITRIAGNAGRQEERGRGFELATSLWGVVRSALGMLITTEAPSNAQSHAKEMDETVRRLAEARDTHERLA
GLAQQNGGQEPNGDQSEVTAALRVQNDAIRGDATTEGHPFPEFAEPHMTLASPAGIETTTAGSTHIASGE
HLALTTGEHLGIATGRSLFATVKEKLRIFVYHAGIKLISGAGSIDIEALKDAINLMAKIRIRQTATKIEI
WAEEELSLRGGKSFITLSNAGITNGTPGQWQSYAATHEMPGPRSAPDDIPAAELKVCELSTIKAAARHAA
IVPLR
 
Nucleotide Sequence: 2538 bp     [Download]
>gi|189351978|ref|NC_010805.1|:c1594753-1592216 Burkholderia multivorans ATCC 17616 chromosome 2, complete genome
ATGGCTTTGTTTGACGCATCACGGACGCTATCGGTTTCCGGCGCGGCGCTGCCGACGTACGGTGGCCAAT
CGCTCCTGACGCCGGTGAAGCTCACGGGTGCCGAGACGATAGGCGAGTTGTTCGAATACGTCCTGGAACT
GAAGACACCAGACGCGCTCGCGTTCTCCCCGAGCATCGCGGCGAACGTCGATCTCGATGCGTTGATCGGC
ACGGAGGTGACCGTATCGATTCAGCTCGAAGGCCGTGGGCATTTCATTCCGGGCCTTGCCGGTGGTGCCG
GCATGGGAAATATCGGCGCAGGCATGCGCGAGATCACCGGCATTGTCAGTCAGGCGACGATCGTTCGCGA
AGACGGCCGCTCGATTGTGTACGCACTGACGCTGCGGCCGTGGCTCTGGCATGCGACTAAAAATTGCGAC
TGCCGCATTTTCCAGGACATGTCGGTTGTCGAGATCACGGATGCCGTGCTGTCGATCTATCCGTTTCCGG
TCGATAAACGGCTGACGACGCCTCGGCCTAACAAGGTATGGCCCAAGCGCGACATTCAGCGCCAGCATTT
CGAAAGCGACTGGGCGTTCCTGCAGCGCTTGTGGGAAGAGTGGGGTATCTACTACTTCTTCGAGCATGGC
GAAGGCAAGCATCGGCTCGTGCTTTGCGATTCGATGGGCGCGCTCCGGCCGCTCGGCGACGCCTATGCCG
AGCTTCGCTACGAACCGCCGACCAGTCGGCGCATCGACGAGGAGCATATCCACGAATTCTCGGTGTCACA
TGCGCTGACCACGGGCGCGGTGACGGCTGTCGACTACGACTACACGTTGCCGCGAGCGAATCTGACCGTG
ACGCGGGAGGATCCCCGCGATACGGGCCTCGCCCATCAGGAGCGCTATTCGTGGGGCGACTATGCACAGC
CGCAAGCGGGGGCGGCCGGACTCTCCGGCGCGCACAACGAGCCGCGCACCGAAGCGGAATACCTCACGCT
GGTACAGATGCAGGCCTGGCGGTGTCAGGGATTGACGGCGCAAGGCAAGGGCAATTTGCGCGGCATGGTC
GCCGGGCAGACGTTCGTGCTGTCGCACTACCCGCAAGAGGCGGCGAATCGCGAGTACGCGGTGATTGCGT
GCCGGCTGATGATCGAAGAGATCGGCGAAGCGTCCGGGGCGGGTCAGCAGTATCGGTGCGAAGCGGATTT
CACCGTGCAACCGACCAATGAGCCGTTTCGTCTATTGCGCACGATAGCGAAGCCGCGCATGAACGGCATC
GAGTATGCCGTCGTGACGTGCCCCGACAACCAGGAAATCTGGACCGATGCCTACGGGCGCGTGAAGCTGC
AGTTTCTCTGGGATCGGCTAGGCAAGAACGACGAGCGTTCCAGTTGTTGGGTGCGCGTTGCCGGCGCCTG
GCACGGCGATCAGTTCGGCGGCGTTTTTCTTCCGCGTCGGGGGCAGGAGGTCGAGGTTGCCTTCGTCAAT
GGCGATCCGGACTTGCCGATCGTCGTGGGAAGCGCGGCGAACGCCTTCAACATGCCGCCGTTCGCGTTGC
CGGCGAATCAGGCGCTCGCCGGCTACCGCAGCAAGGAAATCGGCGGCCGTCGAGCGAATACGCTGGCTTT
CGACGATACGAACGGCAAGATCCAGGCGCATCTGTCGAGCGATGAAGGGTGTTCGCAGTTGAATCTGGGG
TACATCACGCGTATTGCGGGGAATGCGGGGCGGCAGGAGGAAAGGGGAAGGGGGTTTGAACTTGCGACCA
GTCTATGGGGAGTAGTGAGATCGGCATTGGGAATGCTGATCACGACCGAGGCGCCATCGAATGCGCAAAG
CCATGCGAAAGAAATGGACGAAACAGTTCGGCGACTCGCGGAAGCGCGAGACACCCACGAACGGCTGGCT
GGACTGGCTCAGCAGAATGGCGGGCAGGAACCGAACGGTGACCAAAGCGAAGTTACGGCCGCGCTGAGAG
TACAGAACGATGCGATACGAGGGGACGCAACGACGGAGGGCCACCCATTTCCCGAGTTTGCTGAGCCGCA
TATGACGCTTGCCAGTCCGGCGGGCATCGAAACGACGACGGCGGGCAGTACACACATCGCGAGCGGTGAA
CATCTGGCATTGACGACTGGCGAACATCTTGGCATTGCCACAGGGCGATCACTGTTTGCGACCGTCAAGG
AGAAACTGAGAATTTTCGTATACCACGCCGGGATCAAACTCATTTCCGGTGCTGGTTCAATTGACATTGA
AGCTCTCAAGGATGCCATTAACCTGATGGCAAAAATCCGGATCAGGCAAACCGCGACGAAAATTGAAATC
TGGGCGGAAGAAGAGTTGTCGCTTCGTGGCGGGAAGAGCTTCATTACGCTCAGTAACGCGGGGATTACCA
ACGGTACGCCGGGGCAGTGGCAATCGTATGCCGCAACGCACGAGATGCCGGGACCAAGAAGCGCACCCGA
TGACATTCCGGCTGCCGAACTCAAGGTATGTGAACTGAGCACGATCAAAGCGGCTGCTCGGCACGCCGCG
ATCGTGCCGCTTCGGTGA