SecReT6
Protein ID: 189353348
SecReT6 ID289
T6SS typei3
Gene symbol-
Locus tagBMULJ_04588
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome II [GenBank: NC_010805] [Browse all T6SS(s) in this replicon]
Location [Strand]1594815..1596065 [-]
Producthypothetical protein
NoteTssK
UniProt IDA9AQ73
KEGG IDbmu:Bmul_3913, bmj:BMULJ_04588
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.00E-133, Aligned region: 5..415
Protein Sequence: 416 a.a.     [Download]
>gi|189353348|ref|YP_001948975.1| hypothetical protein BMULJ_04588 [Burkholderia multivorans ATCC 17616]
MGSVQLSPFFFGFVHYALDLESLALGKVIVKSAAGVFADGTPFDAPGNTPLPPPLTIRPEHLDQVIYLAV
PVRLPNCEETTFEDTPDSMARYQVFDAELRDSNSVGLAPESVQLSNLRLRLVPEKELGNAWIGLALTSVK
TIRADGSIELDDTIVPPVSGYGASDLLTSWVTKIHDLAHLRANALSQRLAGTDDTTASAATVTDYLLLQI
LNRYEPLLQHMLRVPTTSPAEVYTLLIAMAGELSTHLRTDTRRPLDTHPPYRHTAPHLCLKPLVDDTHRL
LNAVLVRSAQSIALEDRGHGMRNAVVDPADMRGFASLVLAVHAAMPPDVLRQQFLAQAKAGPSEKLPSLV
RSHLPGIGMQALPVPPRQIPFNAGYIYYELTQGGALWEEVVRHGGIALHVAGEFPSLKLELWGVRA
 
Nucleotide Sequence: 1251 bp     [Download]
>gi|189351978|ref|NC_010805.1|:c1596065-1594815 Burkholderia multivorans ATCC 17616 chromosome 2, complete genome
GTGGGGTCAGTTCAGCTGTCGCCGTTTTTCTTCGGTTTCGTGCATTACGCGCTCGATCTGGAGTCGCTCG
CGCTCGGGAAGGTGATCGTCAAATCGGCCGCCGGCGTGTTCGCCGACGGTACGCCATTTGACGCGCCGGG
CAATACGCCGCTGCCGCCGCCGTTGACGATCCGTCCGGAACACCTCGACCAGGTGATCTATCTGGCCGTG
CCGGTACGTTTGCCGAACTGCGAGGAAACGACGTTCGAGGATACGCCCGATTCGATGGCGCGCTATCAGG
TGTTCGATGCCGAGCTGCGCGACTCGAATTCGGTCGGGCTGGCGCCCGAGTCCGTCCAGCTGTCGAACCT
GCGGCTGCGTCTGGTGCCGGAGAAGGAGCTCGGCAACGCATGGATCGGACTTGCGCTGACGAGCGTAAAG
ACCATTCGCGCGGACGGCAGCATCGAACTGGACGACACGATCGTGCCGCCCGTATCGGGCTATGGCGCGA
GCGATTTGCTGACGAGCTGGGTCACGAAGATCCACGATCTCGCTCATCTGCGCGCGAATGCGCTGTCGCA
GCGGCTGGCCGGCACGGACGACACGACCGCAAGTGCGGCGACGGTCACGGATTACCTGCTGTTGCAGATC
CTCAACCGGTACGAGCCGTTGCTGCAGCACATGCTGCGCGTGCCGACCACGTCGCCGGCTGAGGTCTACA
CGCTGCTGATCGCGATGGCGGGCGAGCTGTCGACCCATCTACGCACGGATACGCGCCGGCCGCTCGATAC
GCATCCGCCTTATCGGCATACGGCGCCGCATCTTTGCCTGAAGCCGCTGGTGGACGACACGCACCGGCTG
CTCAATGCCGTGCTCGTGCGTAGCGCGCAGAGCATCGCGCTCGAGGATCGGGGGCACGGCATGCGGAATG
CGGTGGTCGATCCGGCCGATATGCGGGGTTTCGCTTCGCTGGTGCTCGCCGTGCATGCGGCGATGCCGCC
GGACGTGCTGCGTCAGCAGTTTCTCGCGCAAGCGAAGGCGGGGCCGTCGGAAAAGCTGCCGAGCCTCGTG
CGCAGTCATTTGCCGGGTATCGGCATGCAGGCGCTGCCGGTGCCGCCGCGGCAGATTCCGTTCAACGCGG
GATATATCTATTACGAGCTGACACAGGGCGGGGCGCTGTGGGAGGAGGTGGTGCGTCACGGTGGGATCGC
GTTGCATGTGGCGGGGGAGTTTCCGTCACTCAAGCTGGAACTTTGGGGTGTGCGTGCGTAA