SecReT6
Protein ID: 189353351
SecReT6 ID289
T6SS typei3
Gene symbol-
Locus tagBMULJ_04591
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome II [GenBank: NC_010805] [Browse all T6SS(s) in this replicon]
Location [Strand]1597643..1598146 [-]
Productlipoprotein
NoteTssJ
UniProt IDA9AQ70
KEGG IDbmj:BMULJ_04591, bmu:Bmul_3910
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 6.60E-42, Aligned region: 13..159
Protein Sequence: 167 a.a.     [Download]
>gi|189353351|ref|YP_001948978.1| lipoprotein [Burkholderia multivorans ATCC 17616]
MRSILTAASLAVVVLLSACASGEPKPKAPIRLELAINAASDVNPDDRGHAAPIVVRLYELKNGSAFEAAD
FFSLETQEKTVLAADVVKRDQFQLRPGEHRKVVRRPDRETTAIGVIAAYRDLPNAVWRSVYTMPVAPDKA
WYRLVTPKLKLTVDLSAKAVTIEERKK
 
Nucleotide Sequence: 504 bp     [Download]
>gi|189351978|ref|NC_010805.1|:c1598146-1597643 Burkholderia multivorans ATCC 17616 chromosome 2, complete genome
ATGCGTTCGATTCTGACCGCCGCTTCGCTCGCCGTCGTCGTACTGCTCTCGGCCTGCGCGAGCGGCGAAC
CGAAGCCGAAGGCGCCGATTCGGCTCGAACTGGCCATCAACGCGGCATCCGACGTGAATCCGGACGATCG
CGGGCACGCGGCGCCGATCGTGGTGCGTCTCTACGAGCTGAAGAACGGCAGCGCATTCGAAGCGGCGGAT
TTCTTTTCGCTGGAAACACAGGAGAAGACGGTGCTGGCGGCCGACGTCGTCAAGCGCGACCAGTTCCAGT
TGCGCCCCGGCGAGCATCGGAAGGTTGTCCGGCGGCCCGATCGGGAAACGACTGCCATCGGCGTGATCGC
GGCCTATCGCGATCTGCCGAATGCGGTATGGCGGTCGGTCTACACGATGCCTGTCGCGCCCGACAAGGCG
TGGTACCGGCTTGTTACACCGAAGCTGAAACTGACTGTCGATCTCTCGGCCAAGGCCGTCACGATCGAGG
AAAGGAAGAAATGA