SecReT6
Protein ID: 189353352
SecReT6 ID289
T6SS typei3
Gene symbol-
Locus tagBMULJ_04592
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome II [GenBank: NC_010805] [Browse all T6SS(s) in this replicon]
Location [Strand]1598225..1598710 [-]
Producthypothetical protein
NoteTssD
UniProt IDA9AQ69
KEGG IDbmu:Bmul_3909, bmj:BMULJ_04592
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.00E-43, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|189353352|ref|YP_001948979.1| hypothetical protein BMULJ_04592 [Burkholderia multivorans ATCC 17616]
MAQDIFLKIDGINGESLDDKHKDEIEILNWDWEILQESSMHSGSGGGAGKATVKDLTFEHNIDRASPNLM
KYALTGKHIDQAVLVMRKAGGNPLEYLKLTMSDVIVTRVKPSGSKAGEEKSRETVSLSFSKVKQEYVVQN
AQGGSGGAVTASFDIKGNKEA
 
Nucleotide Sequence: 486 bp     [Download]
>gi|189351978|ref|NC_010805.1|:c1598710-1598225 Burkholderia multivorans ATCC 17616 chromosome 2, complete genome
ATGGCACAGGACATTTTTCTGAAGATCGACGGCATCAACGGCGAATCGCTCGACGACAAGCACAAGGACG
AGATCGAGATCCTGAACTGGGATTGGGAAATCCTGCAGGAATCGTCGATGCATTCGGGTAGCGGCGGCGG
CGCCGGGAAGGCGACCGTCAAGGATCTCACGTTCGAGCACAACATCGACCGCGCGAGTCCGAACTTGATG
AAGTACGCGCTGACGGGCAAGCACATCGACCAGGCCGTGCTGGTGATGCGCAAGGCCGGCGGCAACCCGC
TCGAATACCTGAAGCTCACGATGAGCGACGTGATCGTCACGCGCGTGAAGCCGTCGGGCAGCAAGGCCGG
CGAGGAAAAGAGCCGCGAGACGGTGTCCCTGTCGTTCTCGAAGGTGAAGCAGGAGTATGTCGTGCAGAAC
GCGCAGGGCGGAAGCGGCGGCGCCGTCACGGCGAGCTTCGACATCAAGGGCAACAAGGAAGCGTAA