SecReT6
Protein ID: 189353353
SecReT6 ID289
T6SS typei3
Gene symbol-
Locus tagBMULJ_04593
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome II [GenBank: NC_010805] [Browse all T6SS(s) in this replicon]
Location [Strand]1598803..1600296 [-]
Producthypothetical protein
NoteTssC
UniProt IDA9APY8
KEGG IDbmu:Bmul_3908, bmj:BMULJ_04593
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.00E-194, Aligned region: 65..491
Protein Sequence: 497 a.a.     [Download]
>gi|189353353|ref|YP_001948980.1| hypothetical protein BMULJ_04593 [Burkholderia multivorans ATCC 17616]
MAKQQVHAVEAQAATQSDFTQLLEREFRPKTDQARAAVEHAVQTLAEQALTQSITISDDAYKSIAAIIAQ
IDRKLSEQINLILHHDDYQALESAWRGLNHLVSNTETDEHLKIRVMDVSKAELHRTMRRYKGLAWDQSPL
FKQIYEQEYGQLGGEPYGCIVADYYFDHTPPDVDLLGSIAKVAAAAHTPFVTGAAPSVLQMESWQELANP
RDLTKIFTQNLEYTAWNSLRNTEDARYVGLAMPRFLARLPYGAKTNPVDQFDFEEDTNGSDHSRYGWANA
AYAMGVNINRSFKQYGWCSLIRGVESGGTVDNLPCHTFPTDDGGVDMKCPTEIAISDRREAELSKNGFIP
LVHRKNTDHATFIGAQSLQKPAEYHDPDATANANLSARLPYLFACSRFAHYLKCIVRDKIGAFKEREDMQ
RWLNEWIMNYVDADPANSSQDTKARRPLAAAEVLVEDVEGNPGYYQAKFFLRPHFQLEGLTVSLRLVTKL
PSIKEAA
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|189351978|ref|NC_010805.1|:c1600296-1598803 Burkholderia multivorans ATCC 17616 chromosome 2, complete genome
ATGGCAAAACAGCAAGTACACGCCGTCGAGGCGCAGGCCGCGACCCAATCCGATTTCACGCAACTGCTCG
AACGGGAATTCCGGCCGAAGACGGATCAGGCCCGCGCGGCGGTGGAACATGCGGTGCAGACACTCGCGGA
GCAGGCGCTCACGCAGTCGATCACGATCAGCGACGACGCCTACAAGAGCATCGCGGCGATCATCGCGCAG
ATCGATCGCAAGCTCTCCGAGCAAATCAACCTGATCCTGCATCATGACGACTACCAGGCGCTCGAATCCG
CGTGGCGCGGCCTGAACCATCTCGTGTCGAACACCGAGACGGACGAGCACCTGAAGATCCGCGTGATGGA
TGTCTCGAAGGCCGAACTGCATCGTACGATGCGGCGCTACAAGGGGCTGGCGTGGGATCAGAGCCCGCTT
TTCAAGCAGATCTACGAACAGGAATACGGGCAGCTCGGCGGCGAGCCGTACGGGTGCATCGTGGCCGACT
ACTACTTCGACCACACGCCGCCGGACGTCGACCTGCTCGGTTCGATCGCGAAGGTGGCGGCGGCCGCGCA
CACGCCGTTCGTGACCGGTGCGGCGCCTTCGGTGCTGCAGATGGAATCGTGGCAGGAACTGGCGAACCCG
CGCGACCTGACGAAGATCTTCACGCAGAACCTCGAATACACCGCGTGGAATTCGTTGCGCAACACCGAGG
ACGCGCGCTACGTCGGCCTTGCGATGCCGCGCTTCCTGGCGCGGCTGCCGTACGGCGCGAAGACCAATCC
GGTCGACCAATTCGATTTCGAGGAAGACACGAACGGCTCCGACCACAGCCGCTACGGTTGGGCGAACGCG
GCGTATGCAATGGGCGTCAACATCAACCGCTCGTTCAAGCAGTACGGCTGGTGCTCGCTGATCCGCGGCG
TCGAATCGGGCGGCACGGTCGACAACCTGCCGTGCCATACGTTCCCGACCGACGACGGCGGCGTCGACAT
GAAGTGCCCGACCGAGATCGCGATCTCGGATCGTCGCGAGGCCGAGCTGTCGAAGAACGGCTTCATTCCG
CTCGTGCATCGCAAGAATACCGATCACGCGACCTTCATCGGCGCCCAGTCGCTGCAGAAACCGGCCGAGT
ATCACGACCCCGACGCAACCGCGAATGCGAATCTGTCGGCGCGCCTGCCGTACCTGTTCGCCTGCTCGCG
CTTCGCGCATTACCTGAAGTGCATCGTGCGCGACAAGATCGGCGCATTCAAGGAGCGCGAAGACATGCAG
CGCTGGCTCAACGAATGGATCATGAACTACGTCGACGCCGACCCCGCGAACTCGTCGCAGGACACGAAGG
CACGCCGGCCGCTCGCTGCGGCCGAGGTGCTGGTCGAGGACGTCGAAGGCAATCCCGGCTACTACCAGGC
GAAGTTCTTCCTGCGTCCGCACTTCCAGCTCGAAGGACTGACCGTTTCGCTGCGGCTCGTGACGAAGCTG
CCGTCGATCAAGGAAGCCGCTTAA